Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

CXCR6 Blocking Peptide

CXCR6 Blocking Peptide is available 2 times from Fitzgerald labs

33R-1131 | CXCR6 Blocking Peptide size: 100 µg | 240.87 USD

Loading

33R-1131 | CXCR6 Blocking Peptide size: 100 ug | 321.16 USD

Loading
Residues AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL
Category Proteins
Tested for WB; IHC
Product Subtype Blocking Peptides
Type1 Synthetic
Antibody Subtype Blocking Peptides
Shipping Info Blue Ice
Shipping conditions Blue Ice
Applications WB, IHC
Type of protein Synthetic
Research Area Cell Biology
Tag/Conjugate AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Product Type Proteins
Area of research Cell Biology
Test You can block the antibody by the specific target amino acid sequence of peptide.
Properties blocking peptide
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Gene targetCXCR6
Short name CXCR6 Blocking Peptide
Technique blocking peptide, Blocking, peptide
Alternative name chemokine (C-X-C motif) receptor 6 inhibiting short protein sequence
Alternative technique control
Alternative to gene target chemokine (C-X-C motif) receptor 6, BONZO and CD186 and STRL33 and TYMSTR, CXCR6 and IDBG-29993 and ENSG00000172215 and 10663, C-X-C chemokine receptor activity, Plasma membranes, Cxcr6 and IDBG-206490 and ENSMUSG00000048521 and 80901, CXCR6 and IDBG-646261 and ENSBTAG00000015708 and 506807
Similar products
Ask
Ajax processing
Close
CXCR6 Blocking Peptide - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee