NUR77 Antibody

• Catalog number
  R32021
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  NUR77
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the NUR77 antibody should be determined by the researcher.
• Intented use
  This NUR77 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P22736
• Purity
  Antigen affinity
• Description
  Nuclear receptor subfamily 4, group A, member 1, also called NAK1, GFRP1, TR3, NUR77 or NGFIB, is a protein that in humans is encoded by the NR4A1 gene, and a member of the Nur nuclear receptor family of intracellular transcription factors. NR4A1 is involved in cell cycle mediation, inflammation and apoptosis. It plays a key role in mediating inflammatory responses in macrophages. In addition, subcellular localization of the NR4A1 protein appears to play a key role in the survival and death of cells. Nr4a1 is overexpressed in Wnt1 -transformed mouse mammary cells. Nr4a1 is also induced by lithium, a Wnt1 mimic, and the Nr4a1 promoter is activated by lithium and beta-catenin, a Wnt1 downstream effector. In contrast, human NR4A1 is not upregulated by beta-catenin, indicating that this gene is regulated differently in human and mouse cells. Adenoviral expression of Nr4a1 induces genes involved in gluconeogenesis, stimulates glucose production both in vitro and in vivo, and raises blood glucose levels.
• Immunogen
  Amino acids HLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYD of human NUR77 were used as the immunogen for the NUR77 antibody.
• Storage
  After reconstitution, the NUR77 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  NUR77  
• Gene symbol
  NR4A1
• Short name
  Anti-NUR77
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to NUR77
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:7980
• Gene
  NR4A1
• Long gene name
  nuclear receptor subfamily 4 group A member 1
• Synonyms gene
  • HMR
  • GFRP1
• Synonyms gene name
  • nuclear receptor subfamily 4, group A, member 1
• Synonyms
  • TR3
  • N10
  • NAK-1
  • NGFIB
  • NUR77
• GenBank acession
  • L13740
• Locus
  12q13.13
• Discovery year
  1990-09-10
• Entrez gene record
  3164
• Pubmed identfication
  • 2626032
• Classification
  • Nuclear receptor subfamily 4 group A
• VEGA ID
  OTTHUMG00000150393

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products