E2F4 Antibody

• Catalog number
  PB10057
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  E2F4
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  mouse, rat
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the N-terminus of human E2F4 (106-144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED), identical to the related mouse and rat sequences.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the E2F4 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The E2F4 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  Transcription factor E2F4 is a protein that in humans is encoded by the E2F4 gene. The protein encoded by this gene is a member of the E2F family of transcription factors. This gene is mapped to 16q22.1. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. Additionally, it plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.
• Related articles
  1. Ginsberg, D., Vairo, G., Chittenden, T., Xiao, Z.-X., Xu, G., Wydner, K. L., DeCaprio, J. A., Lawrence, J. B., Livingston, D. M. E2F-4, a new member of the E2F transcription factor family, interacts with p107. Genes Dev. 8: 2665-2679, 1994. 2. Leone, G., Sears, R., Huang, E., Rempel, R., Nuckolls, F., Park, C.-H., Giangrande, P., Wu, L., Saavedra, H. I., Field, S. J., Thompson, M. A., Yang, H., Fujiwara, Y., Greenberg, M. E., Orkin, S., Smith, C., Nevins, J. R. Myc requires distinct E2F activities to induce S phase and apoptosis. Molec. Cell 8: 105-113, 2001.
• Gene Name
  E2F4
• Protein Name
  Transcription factor E2F4
• Gene Full Name
  E2F transcription factor 4, p107/p130-binding
• Synonyms
  E2F4 | E2F-4 | Transcription factor E2F4 | Q16254
• Uniprot ID
  Q16254
• Entrez GeneID
  1874
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  E2F4  
• Gene symbol
  E2F4
• Short name
  E2F4 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  E2F4 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:3118
• Gene
  E2F4
• Long gene name
  E2F transcription factor 4
• Synonyms gene name
  • E2F transcription factor 4, p107/p130-binding
• Synonyms
  • E2F-4
• GenBank acession
  • BC021050
• Locus
  16q22.1
• Discovery year
  1995-02-01
• Entrez gene record
  1874
• Pubmed identfication
  • 7958924
  • 7892279
• RefSeq identity
  • NM_001950
• Classification
  • E2F transcription factors
• VEGA ID
  OTTHUMG00000172975

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products