Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

IL8RB Blocking Peptide

IL8RB Blocking Peptide is available 1 time from Fitzgerald labs

33R-5899 | IL8RB Blocking Peptide size: 100 µg | 240.87 USD

Loading
Residues MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF
Category Proteins
Tested for WB; IHC
Product Subtype Blocking Peptides
Type1 Synthetic
Antibody Subtype Blocking Peptides
Shipping Info Blue Ice
Shipping conditions Blue Ice
Applications WB, IHC
Research Area Cytokines & Growth Factors
Type of protein Synthetic
Tag/Conjugate MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Product Type Proteins
Area of research Cytokines & Growth Factors
Test You can block the antibody by the specific target amino acid sequence of peptide.
Properties blocking peptide
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Gene targetIL8RB
Short name IL8RB Blocking Peptide
Technique blocking peptide, Blocking, peptide
Alternative name IL8RB inhibiting short protein sequence
Alternative technique control
Similar products
IL8RB Blocking Peptide (N-term) Suppplier: MyBioSource
Price: 253.49 USD
Ask
Ajax processing
Close
IL8RB Blocking Peptide - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee