Recombinant Pseudomonas aeruginosa Beta-lactamase(ampC)

• Catalog number
  RPC20115
• Price
  Please ask
• Size
  50 μg

• Verified reactivity
  Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
• Protein number
  P24735
• Gene number
  ampC
• Other name
  Cephalosporinase
• Protein origin
  E.coli
• Protein region
  27-397aa
• Protein sequence
  GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR
• Information about sequence
  Full Length
• Expected molecular weight
  56.65kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• About
  Pseudomonas is a Gram-negative bacteria. Pseudomonas genomic sequences are used in medical research. A problem in hostpital is often the Pseudomonas Aeruginosa containing multi drug resistancy properties that are transmitted through plasmids. The MDR property is transmitter by the R plasmid.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Pseudomonas   aeruginosa   Beta-lactamase   ampC  
• Short name
  Recombinant Pseudomonas aeruginosa Beta-lactamase(ampC)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-SUMO-tagged
• Species
  Pseudomonas, Pseudomonas
• Alternative name
  Rec. Pseudomonas aeruginosa b-lactamase(ampC)
• Alternative technique
  rec

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products