Enolase, Neuron Specific (NSE) Monoclonal Antibody

  • Catalog number
    CAU29488
  • Price
    Please ask
  • Size
    200 μg
  • Other name
    ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase
  • Immunogen
    Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
  • Verified reactivity
    Homo sapiens (Human)
  • Verified applications
    WB, ICC, IHC-P, IHC-F, ELISA
  • Raised in
    Mouse
  • Clonality
    Monoclonal
  • Protein number
    Please see Uniprot
  • Gene number
    Please refer to GenBank
  • NCBI number
    Please refer to NCBI
  • Purity
    Affinity purified. Please contact us for more details
  • Antibody s concentration
    500μg/ml
  • Stroage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Supplementary information
    Applicable secondary antibody is available. Please inquire
  • Notes
    For research use only. Not for diagnostic procedures.
  • Properties
    If you buy Antibodies supplied by bioma they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.
  • French translation
    anticorps
  • Gene target
  • Short name
    Enolase, Neuron Specific (NSE) Monoclonal Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for, Monoclonals or monoclonal antibodies
  • Label
    Unconjugated. Biotin/FITC/Cy3/Cy5 labelling is available, please inquire.
  • Alternative name
    Enolase, Neuron Specific (NSE) monoclonal (antibody to-)
  • Alternative technique
    antibodies
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee