Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human Hepcidin HAMP N GST

Recombinant Human Hepcidin HAMP N GST is available 4 times from Novo labs

CH13-1000 | Recombinant Human Hepcidin/HAMP (N-GST) size: 1 mg | 2,777.61 USD

Loading

CH13-10 | Recombinant Human Hepcidin/HAMP (N-GST) size: 10 ug | 226.81 USD

Loading

CH13-50 | Recombinant Human Hepcidin/HAMP (N-GST) size: 50 ug | 555.30 USD

Catalog number CH13-50
Supplier novo
Price 555.30 USD
Size 50 ug
Storage conditions Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
1. Gene info
Identity7064
GeneMGST3
Synonyms
GenBank acession
Locus1q24.1
Discovery year1997-10-16
Pubmed identfication
RefSeq identity
Havana BLAST/BLATOTTHUMG00000034627
2. Gene info
Identity15598
GeneHAMP
GenBank acession
Discovery year2001-05-29
Pubmed identfication
RefSeq identity
Havana BLAST/BLATOTTHUMG00000183295
Locus Specific Databases
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Human#.jpg

CH13-500 | Recombinant Human Hepcidin/HAMP (N-GST) size: 500 ug | 1,961.98 USD

Loading
Description Recombinant Human Hepcidin is produced by our E.coli expression system and the target gene encoding Asp60-Thr84 is expressed with a GST tag at the N-terminus.
Species reactivity Human
Origin Escherichia coli
Peptide sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDTHFPICIFCCGCCHRSKCGMCCKT
Estimated molecular weight 2,92 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Dry ice/ice packs
Package form Supplied as a 0.2 µm filtered solution of PBS,50%glycerol,pH7.4.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number P81172
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Gene targetHepcidin/HAMP N-GST
Short name Recombinant Hepcidin/HAMP (N-GST)
Technique Recombinant
Species Human
Alternative name recombinant H. sapiens Hepcidin/hepcidin antimicrobial peptide (N-GST)
Alternative technique rec
Alternative to gene target hepcidin antimicrobial peptide, HAMP and IDBG-43921 and ENSG00000105697 and 57817, hormone activity, Extracellular, HAMP and IDBG-635586 and ENSBTAG00000017042 and 512301
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
Recombinant Human Hepcidin/HAMP (N-GST) size: 50 ug
Filters
+32-(0)1-658-90-45 [email protected]
  • Hepcidin/HAMP
  • N-GST
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee