-
Target antigen
ARID1A
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, rat
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ARID1A (1021-1053aa KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR), identical to the related mouse sequence.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the ARID1A Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The ARID1A Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.
-
Related articles
1. Dallas, P. B., Pacchione, S., Wilsker, D., Bowrin, V., Kobayashi, R., Moran, E. The human SWI-SNF complex protein p270 is an ARID family member with non-sequence-specific DNA binding activity. Molec. Cell. Biol. 20: 3137-3146, 2000. 2. Krosl, J., Mamo, A., Chagraoui, J., Wilhelm, B. T., Girard, S., Louis, I., Lessard, J., Perreault, C., Sauvageau, G. A mutant allele of the Swi/Snf member BAF250a determines the pool size of fetal liver hemopoietic stem cell populations. Blood 116: 1678-1684, 2010. 3. Nie, Z., Xue, Y., Yang, D., Zhou, S., Deroo, B. J., Archer, T. K., Wang, W. A specificity and targeting subunit of a human SWI/SNF family-related chromatin-remodeling complex. Molec. Cell. Biol. 20: 8879-8888, 2000.
-
Gene Name
ARID1A
-
Protein Name
AT-rich interactive domain-containing protein 1A
-
Gene Full Name
AT rich interactive domain 1A (SWI-like)
-
Synonyms
actin-dependent regulator of chromatin subfamily F member 1 antibody|ARI1A_HUMAN antibody| ARID domain containing protein 1A antibody|ARID domain-containing protein 1A antibody| ARID1A antibody|AT rich interactive domain 1A (SWI like) antibody|AT rich interactive domain 1A antibody|AT rich interactive domain containing protein 1A antibody|AT-rich interactive domain-containing protein 1A antibody|B120 antibody|BAF250 antibody|BAF250A antibody|BM029 antibody|brain protein 120 antibody|BRG1 associated factor 250 antibody|BRG1 associated factor 250a antibody|BRG1-associated factor 250 antibody|BRG1-associated factor 250a antibody|C1ORF4 antibody|chromatin remodeling factor p250 antibody|chromosome 1 open reading frame 4 antibody|hELD antibody|hOSA1 antibody|matrix-associated antibody|Osa homolog 1 antibody|OSA1 antibody|OSA1 nuclear protein antibody|P270 antibody|SMARCF1 antibody|SWI like protein antibody|SWI SNF complex protein p270 antibody|SWI-like protein antibody|SWI/SNF complex protein p270 antibody|SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1 antibody|SWI/SNF-related antibody
-
Uniprot ID
O14497
-
Entrez GeneID
8289
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps