Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Anti-SOX10 Picoband antibody

Anti-SOX10 Picoband antibody is available 1 time from Boster labs

A00758-1 | Anti-SOX10 Picoband antibody size: 100µg/vial | 432.74 USD

Catalog number A00758-1
Supplier boster
Price 432.74 USD
Size 100µg/vial
1. Gene info
Identity11190
GeneSOX10
Long gene nameSRY-box 10
Synonyms gene name
  • SRY (sex determining region Y)-box 10
  • SRY box 10
Synonyms
Locus22q13.1
Discovery year1998-01-22
Pubmed identfication
RefSeq identity
Havana BLAST/BLATOTTHUMG00000149913
MeSH Data
Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
Clonality Polyclonal
Storage & Transport Conditions At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Form Lyophilized
Product Datasheet www.bosterbio.com/datasheet.php?sku=A00758-1
Sample Size Available 30ug for $99, contact us for details
Immunogen A synthetic peptide corresponding to a sequence of human SOX10 (KPHIDFGNVDIGEISHEVMSNMETFDVAELDQYL).
Purification NA
Applications WB
Cross-reactivity No cross reactivity with other proteins.
Ig Type N/A
Application Details Western blot, 0.1-0.5µg/ml
Reactivity Human, Mouse, Rat
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
Properties If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetSOX10 Picoband
Short name Anti-SOX10 Picoband antibody
Technique Antibody, anti
Alternative name antibody to-SOX10 Picoband (Antibody to)
Alternative technique antibodies
Similar products
Anti-MVP Picoband antibody Suppplier: boster
Price: 477.13 USD
Anti-Psoriasin Picoband antibody Suppplier: boster
Price: 477.13 USD
Anti-CCKBR Picoband antibody Suppplier: boster
Price: 477.13 USD
Anti-Frizzled 4 Picoband antibody Suppplier: boster
Price: 477.13 USD
Anti-CD163 Picoband antibody Suppplier: boster
Price: 477.13 USD
Anti-IGF2R Picoband antibody Suppplier: boster
Price: 477.13 USD
Anti-Integrin alpha 5 Picoband antibody Suppplier: boster
Price: 477.13 USD
Anti-PRDM1/Blimp1 Picoband antibody Suppplier: boster
Price: 477.13 USD
Anti-XRCC1 Picoband antibody Suppplier: boster
Price: 477.13 USD
Anti-HTRA1/Htra Picoband antibody Suppplier: boster
Price: 477.13 USD
Anti-GLO1/Glyoxalase I Picoband antibody Suppplier: boster
Price: 477.13 USD
Anti-PERK Picoband antibody Suppplier: boster
Price: 432.74 USD
Anti-STAT2 Picoband antibody Suppplier: boster
Price: 432.74 USD
Anti-IL4 Picoband antibody Suppplier: boster
Price: 432.74 USD
Anti-Alpha 1 Fetoprotein Picoband antibody Suppplier: boster
Price: 432.74 USD
Anti-SCNN1A Picoband antibody Suppplier: boster
Price: 432.74 USD
Anti-HLA-DQB1/Hla Dqb1 Picoband antibody Suppplier: boster
Price: 432.74 USD
Anti-IRAK Picoband antibody Suppplier: boster
Price: 432.74 USD
Ask
Ajax processing
Close
Anti-SOX10 Picoband antibody size: 100µg/vial - Gentaur.com
Filters
+32-(0)1-658-90-45 [email protected]
  • SOX10
  • Picoband
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee