Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 17/TNFRSF17/BCMA (C-Fc)
-
Catalog number
CU46-500
-
Price
Please ask
-
Size
500 ug
-
-
Description
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 17 is produced by our expression system and the target gene encoding Met1-Thr49 is expressed
-
Species reactivity
Mouse
-
Origin
Human cells
-
Peptide sequence
MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
-
Estimated molecular weight
32.1
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Ambient/Room Temperature
-
Package form
Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
-
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
-
Reconstitution conditions
See included datasheet or contact us for more information.
-
UniProt number
O88472
-
-
Additional description
Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells. The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
-
Latin name
Mus musculus
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Gene target
-
Gene symbol
TNFRSF17
-
Short name
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 17/TNFRSF17/BCMA (C-Fc)
-
Technique
Recombinant, Mouse, FC, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Host
mouse
-
Species
Mouse, Mouses
-
Alternative name
Recombinant Mouse TNFRSF17/BCMA (C-Fc)
-
Alternative technique
rec, murine
-
Alternative to gene target
tumor necrosis factor receptor superfamily, member 17, BCM and BCMA and CD269 and TNFRSF13A, TNFRSF17 and IDBG-15042 and ENSG00000048462 and 608, tumor necrosis factor-activated receptor activity, Plasma membranes, Tnfrsf17 and IDBG-133357 and ENSMUSG00000022496 and 21935
-
Tissue
tumor
-
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products