Rabbit PCDH8 antibody
-
Catalog number70R-6180
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenPCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG
-
SpecificityPCDH8 antibody was raised against the middle region of PCDH8
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDH8 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPCDH8
-
Short nameRabbit PCDH8 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PCDH8 antibody raised against the middle region of PCDH8
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetprotocadherin 8, ARCADLIN and PAPC, PCDH8 and IDBG-36060 and ENSG00000136099 and 5100, calcium ion binding, Cell surfaces, Pcdh8 and IDBG-183100 and ENSMUSG00000036422 and 18530, PCDH8 and IDBG-628623 and ENSBTAG00000018179 and 513346
-
Gene info
-
Identity
-
Gene
-
Long gene nameprotocadherin 8
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-04-21
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Non-clustered protocadherins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data