Rabbit DYNLL1 antibody
-
Catalog number70R-2617
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenDYNLL1 antibody was raised using the middle region of DYNLL1 corresponding to a region with amino acids EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL
-
SpecificityDYNLL1 antibody was raised against the middle region of DYNLL1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DYNLL1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolNRAV, DYNLL1
-
Short nameRabbit DYNLL1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal DYNLL1 antibody raised against the middle region of DYNLL1
-
Alternative techniqueantibodies, rabbit-anti
-
Gene info
-
Identity
-
Gene
-
Long gene namenegative regulator of antiviral response
-
Synonyms gene
-
Synonyms gene name
- DYNLL1 antisense RNA 1
- negative regulator of antiviral response (non-protein coding)
-
GenBank acession
-
Locus
-
Discovery year2013-05-30
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Long non-coding RNAs with non-systematic symbols
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namedynein light chain LC8-type 1
-
Synonyms gene
-
Synonyms gene name
- dynein, cytoplasmic, light polypeptide 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-12-18
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Dyneins, axonemal inner arm I1/f complex subunits
- Dynein 2 complex subunits
- Dynein 1 complex subunits
- Dyneins, axonemal outer arm complex subunits
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data