Rabbit NOX1 antibody

• Catalog number
  70R-7398
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  NOX1 antibody was raised using the C terminal of NOX1 corresponding to a region with amino acids STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
• Specificity
  NOX1 antibody was raised against the C terminal of NOX1
• Cross Reactivity
  Human,Dog
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOX1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  NOX1  
• Gene symbol
  NOX1
• Short name
  Rabbit NOX1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal NOX1 antibody raised against the C terminal of NOX1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  NADPH oxidase 1, NOX1 and IDBG-79287 and ENSG00000007952 and 27035, NADP binding, Cell surfaces, Nox1 and IDBG-170699 and ENSMUSG00000031257 and 237038, NOX1 and IDBG-633329 and ENSBTAG00000016761 and 521681

Gene info

• Identity
  HGNC:7889
• Gene
  NOX1
• Long gene name
  NADPH oxidase 1
• Synonyms
  • NOH1
  • NOH-1
  • MOX1
  • GP91-2
• Synonyms name
  • mitogenic oxidase (pyridine nucleotide-dependent superoxide-generating)
  • NADPH oxidase homolog-1
  • NADPH oxidase 1 variant NOH-1L
• GenBank acession
  • AF127763
• Locus
  Xq22.1
• Discovery year
  2000-03-24
• Entrez gene record
  27035
• Pubmed identfication
  • 10485709
  • 10615049
• RefSeq identity
  • NM_007052
• VEGA ID
  OTTHUMG00000022007
• Locus Specific Databases
  • Global Variome shared LOVD

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products