Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

IL10R Alpha Blocking Peptide

IL10R Alpha Blocking Peptide is available 2 times from Fitzgerald labs

33R-3595 | IL10R Alpha Blocking Peptide size: 100 ug | 321.38 USD

Loading

33R-3595 | IL10R Alpha Blocking Peptide size: 100 µg | 241.04 USD

Loading
Residues GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
Category Proteins
Tested for WB; IHC
Product Subtype Blocking Peptides
Type1 Synthetic
Antibody Subtype Blocking Peptides
Shipping Info Blue Ice
Shipping conditions Blue Ice
Applications WB, IHC
Research Area Cytokines & Growth Factors
Type of protein Synthetic
Tag/Conjugate GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Product Type Proteins
Area of research Cytokines & Growth Factors
Description The IL10R Alpha Blocking Peptide is a α- or alpha protein sometimes glycoprotein present in blood.Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Test You can block the antibody by the specific target amino acid sequence of peptide.
Properties blocking peptide
Gene targetIL10R Alpha
Short name IL10R Alpha Blocking Peptide
Technique blocking peptide, Blocking, peptide
Alternative name IL10R a inhibiting short protein sequence
Alternative technique control
Similar products
Integrin alpha 7 LC Blocking Peptide Suppplier: MyBioSource
Price: 0.00 USD
AMPK alpha 1 (pS496) Blocking Peptide Suppplier: MyBioSource
Price: 304.17 USD
LXR alpha Blocking Peptide Suppplier: abbex
Price: 329.42 USD
Alpha Amylase Blocking Peptide Suppplier: MyBioSource
Price: 0.00 USD
Inhibin alpha Blocking Peptide Suppplier: abbex
Price: 348.93 USD
ACTA1/Alpha-actin Antibody (C-term) Blocking peptide Suppplier: MyBioSource
Price: 253.66 USD
IFN Alpha 5 Blocking Peptide Suppplier: fitzgerald
Price: 241.04 USD
PKC alpha (pY657) Blocking Peptide Suppplier: MyBioSource
Price: 304.17 USD
Estrogen Receptor alpha Blocking Peptide Suppplier: abbex
Price: 329.42 USD
CK2 alpha Blocking Peptide Suppplier: abbex
Price: 348.93 USD
HP1 alpha Blocking Peptide Suppplier: MyBioSource
Price: 0.00 USD
FAP alpha Blocking Peptide Suppplier: MyBioSource
Price: 260.55 USD
mPR alpha Blocking Peptide Suppplier: MyBioSource
Price: 260.55 USD
PDE6 Alpha Blocking Peptide sequence Suppplier: fabgen
Price: 250.45 USD
RhoGDI alpha (pS174) Blocking Peptide Suppplier: MyBioSource
Price: 304.17 USD
Parvalbumin alpha Blocking Peptide Suppplier: MyBioSource
Price: 0.00 USD
Alpha-adducin (pT445) Blocking Peptide Suppplier: MyBioSource
Price: 304.17 USD
Ask
Ajax processing
Close
IL10R Alpha Blocking Peptide - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee