Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

SLC35C1 Blocking Peptide

SLC35C1 Blocking Peptide is available 2 times from Fitzgerald labs

33R-9287 | SLC35C1 Blocking Peptide size: 100 ug | 339.44 USD

Catalog number 33R-9287
Supplier fitzgerald
Price 339.44 USD
Size 100 ug
Alternative name SLC35C1 inhibiting short protein sequence
1. Gene info
Identity 20197
Gene SLC35C1
Long gene name solute carrier family 35 member C1
Synonyms gene name
  • solute carrier family 35, member C1
  • solute carrier family 35 (GDP-fucose transporter), member C1
Synonyms
  • FUCT1
  • FLJ11320
Locus 11p11.2
Discovery year 2003-10-08
Entrez gene record 55343
Pubmed identfication
  • 11326279
  • 11326280
RefSeq identity
  • NM_018389
Classification
  • Solute carriers
Havana BLAST/BLAT OTTHUMG00000166519
Locus Specific Databases
  • Congenital Disorder of Glycosylation pages
  • SLC35C1base: Mutation registry for Leucocyte adhesion deficiency I I (LAD-II) (previously known as FUCT1base)
  • LRG_107

33R-9287 | SLC35C1 Blocking Peptide size: 100 µg | 254.58 USD

Loading
Product Type Proteins
Product Subtype Blocking Peptides
Research Area Cell Biology
Tag/Conjugate TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG
Type1 Synthetic
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Applications WB, IHC
Shipping Info Blue Ice
Category Proteins
Antibody Subtype Blocking Peptides
Area of research Cell Biology
Residues TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG
Type of protein Synthetic
Shipping conditions Blue Ice
Tested for WB; IHC
Test You can block the antibody by the specific target amino acid sequence of peptide.
Properties blocking peptide
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Gene targetSLC35C1
Short name SLC35C1 Blocking Peptide
Technique blocking peptide, Blocking, peptide
Alternative technique control
Similar products
Human P53 ELISA kit Suppplier: abbex
Price: 948.02 USD
Mouse pre-microRNA Expression Construct mir-328 Suppplier: Systembio
Price: 858.31 USD
TULP1 ELISA KIT|Human Suppplier: Lifescience Market
Price: 835.27 USD
Porcine Cadherin-11 (CDH11) ELISA Kit Suppplier: MyBioSource
Price: 689.80 USD
Rabbit FOXC1 (Forkhead Box Protein C1) ELISA Kit Suppplier: MyBioSource
Price: 663.13 USD
GBP1 cloning plasmid Suppplier: Cusabio
Price: 455.82 USD
YIPF4 Polyclonal Antibody Suppplier: Epigen
Price: 389.15 USD
TRANSFERRIN Antibody Suppplier: BioGenEx Antibodies
Price: 375.81 USD
Recombinant Corynebacterium aurimucosum Probable Suppplier: MyBioSource
Price: 6.06 USD
Pig CRP Reference Standard Suppplier: MyBioSource
Price: 6.06 USD
Calcium Sensing Receptor Peptide Suppplier: MyBioSource
Price: 6.06 USD
Rps27l/ Rat Rps27l ELISA Kit Suppplier: Lifescience Market
Price: 1 074.10 USD
Geobacter bemidjiensis Potassium transporting ATPase chain Suppplier: MBS Recombinant
Price: 1 922.71 USD
(2S)-2-Isopropylpiperazine dihydrochloride Suppplier: SFC
Price: 0.00 USD
Gm6253 3 UTR Lenti reporter Suppplier: ABM microrna
Price: 0.00 USD
Cdk15 3'UTR Luciferase Stable Cell Line Suppplier: ABM microrna
Price: 0.00 USD
Dpp10 3 UTR Luciferase Stable Cell Line Suppplier: ABM microrna
Price: 0.00 USD
Ask
Ajax processing
Close
SLC35C1 Blocking Peptide | Technique alternative | 020119600
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • SLC35C1
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee