Human Recombinant GSTP1

• Catalog number
  6347-100
• Price
  Please ask
• Size
  100 ug

• Synonyms
  Human Recombinant GSTP1
• Alternative_names
  Glutathione S-transferase P, DFN7, FAEES3, GST3, PI
• Description
  Plays a role in detoxification of electrophilic compounds
• Recombinant
  Yes
• Source
  E. Coli
• Purity by SDS PAGE
  ≥95%
• Assay
  SDS-PAGE
• Endotoxin Level
  < 1.0 EU per 1 ug of protein (determined by LAL method).
• Biological activity
  Specific activity is 20 U/mg
• Unit Definition
  One unit of the human recombinant GSTP1 is defined as the amount of enzyme that conjugates 1.0 µmole of 1-chloro-2, 4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25°C.
• Molecular Weight
  27.6 kDa
• Storage Temp
  -20°C
• Shipping
  gel pack
• Shelf Life
  12 months
• Concentration
  2 mg/ml
• Appearance
  Liquid
• Physical form description
  2.0 mg/ml solution in 30% glycerol without additives.
• Background Information
  Glutathione S-transferase P is an enzyme that in humans is encoded by the GSTP1 gene. Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. The glutathione S-transferase pi gene (GSTP1) is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.
• Amino acid sequence
  MGSSHHHHHHSSGLVPRGSHMPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
• Handling
  Centrifuge the vial prior to opening.
• Usage
  For Research Use Only! Not to be used in humans
• Datasheet
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Additional source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  GSTP1  
• Gene symbol
  GSTP1
• Short name
  Recombinant GSTP1
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  H. sapiens Rec. glutathione S-transferase pi 1
• Alternative technique
  rec
• Alternative to gene target
  glutathione S-transferase pi 1, DFN7 and FAEES3 and GST3 and GSTP and HEL-S-22 and PI, GSTP1 and IDBG-60718 and ENSG00000084207 and 2950, nitric oxide binding, nuclei, GSTP1 and IDBG-644794 and ENSBTAG00000003548 and 281806

Gene info

• Identity
  HGNC:4638
• Gene
  GSTP1
• Long gene name
  glutathione S-transferase pi 1
• Synonyms gene
  • FAEES3
  • GST3
• Synonyms
  • GSTP
• GenBank acession
  • U12472
• Locus
  11q13.2
• Discovery year
  1986-01-01
• Entrez gene record
  2950
• Pubmed identfication
  • 1885604
  • 7587384
  • 19915149
• RefSeq identity
  • NM_000852
• Classification
  • Soluble glutathione S-transferases
• VEGA ID
  OTTHUMG00000137430
• Locus Specific Databases
  • LRG_723

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products