Rabbit DDX58 antibody

• Catalog number
  70R-4680
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  DNA & RNA
• Immunogen
  DDX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX58 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  DDX58  
• Gene symbol
  DDX58
• Short name
  Rabbit DDX58 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal DDX58 antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  DEAD (Asp-Glu-Ala-Asp) box polypeptide 58, RIG-I and RIGI and RLR-1, DDX58 and IDBG-55854 and ENSG00000107201 and 23586, hydrolase activity, Cell surfaces, Ddx58 and IDBG-135957 and ENSMUSG00000040296 and 230073, DDX58 and IDBG-629773 and ENSBTAG00000003366 and 504760

Gene info

• Identity
  HGNC:19102
• Gene
  DDX58
• Long gene name
  DExD/H-box helicase 58
• Synonyms gene name
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 58
• Synonyms
  • RIG-I
  • FLJ13599
  • DKFZp434J1111
  • RIG-1
  • RIG1
• Synonyms name
  • RNA helicase RIG-I
  • retinoic acid inducible gene I
• GenBank acession
  • AF038963
• Locus
  9p21.1
• Discovery year
  2004-05-10
• Entrez gene record
  23586
• Pubmed identfication
  • 21690088
• RefSeq identity
  • NM_014314
• Classification
  • DEAD-box helicases
  • Caspase recruitment domain containing
• VEGA ID
  OTTHUMG00000019746

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products