Recombinant Rat Alpha-synuclein(Snca)

  • Catalog number
    RPC20087
  • Price
    Please ask
  • Size
    200 μg
  • Verified reactivity
    Rattus norvegicus (Rat)
  • Protein number
    P37377
  • Gene number
    Snca
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    1-140aa
  • Protein sequence
    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA
  • Information about sequence
    Full Length
  • Expected molecular weight
    41.9kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    The Recombinant Alpha-synuclein(Snca) is a α- or alpha protein sometimes glycoprotein present in blood.
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    SNCA
  • Short name
    Recombinant Alpha-synuclein(Snca)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Rat
  • Label
    N-terminal GST-tagged
  • Species
    Rat, Rats
  • Alternative name
    Rec. Rat a-synuclein(synuclein, alpha (non A4 component on amyloid precursor))
  • Alternative technique
    rec
  • Alternative to gene target
    synuclein, alpha (non A4 component of amyloid precursor), NACP and PARK1 and PARK4 and PD1, SNCA and IDBG-30077 and ENSG00000145335 and 6622, phosphoprotein binding, nuclei, Snca and IDBG-152558 and ENSMUSG00000025889 and 20617, SNCA and IDBG-641103 and ENSBTAG00000024957 and 282857
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee