Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

FXYD7 Blocking Peptide

FXYD7 Blocking Peptide is available 2 times from Fitzgerald labs

33R-5788 | FXYD7 Blocking Peptide size: 100 µg | 232.28 USD

Loading

33R-5788 | FXYD7 Blocking Peptide size: 100 ug | 309.71 USD

Catalog number 33R-5788
Supplier fitzgerald
Price 309.71 USD
Size 100 ug
1. Gene info
Identity4034
GeneFXYD7
Synonyms gene name
  • FXYD domain-containing ion transport regulator 7
GenBank acession
Discovery year2000-05-23
RefSeq identity
Havana BLAST/BLATOTTHUMG00000182348
Residues MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK
Category Proteins
Tested for WB; IHC
Product Subtype Blocking Peptides
Type1 Synthetic
Antibody Subtype Blocking Peptides
Shipping Info Blue Ice
Shipping conditions Blue Ice
Applications WB, IHC
Type of protein Synthetic
Research Area Signal Transduction
Tag/Conjugate MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Product Type Proteins
Area of research Signal Transduction
Test You can block the antibody by the specific target amino acid sequence of peptide.
Properties blocking peptide
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Gene targetFXYD7
Short name FXYD7 Blocking Peptide
Technique blocking peptide, Blocking, peptide
Alternative name FXYD7 inhibiting short protein sequence
Alternative technique control
Similar products
Ask
Ajax processing
Close
FXYD7 Blocking Peptide size: 100 ug - Gentaur.com
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • FXYD7
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee