HSP90AB1 Blocking Peptide

• Catalog number
  33R-1357
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Protein Modification & Stress Response
• Tag Conjugate
  ALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPL
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  HSP90AB1  
• Gene symbol
  HSP90AB1
• Short name
  HSP90AB1 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  heat shock protein 90kDa a (cytosolic), class B member 1 inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  heat shock protein 90kDa alpha (cytosolic), class B member 1, D6S182 and HSP84 and HSP90B and HSPC2 and HSPCB, HSP90AB1 and IDBG-89293 and ENSG00000096384 and 3326, unfolded protein binding, Cell surfaces, Hsp90ab1 and IDBG-185482 and ENSMUSG00000023944 and 15516, BT.64721 and IDBG-638535 and ENSBTAG00000047699 and 767874

Gene info

• Identity
  HGNC:5258
• Gene
  HSP90AB1
• Long gene name
  heat shock protein 90 alpha family class B member 1
• Synonyms gene
  • HSPC2
  • HSPCB
• Synonyms gene name
  • heat shock 90kD protein 1, beta
  • heat shock 90kDa protein 1, beta
  • heat shock protein 90kDa alpha (cytosolic), class B member 1
• GenBank acession
  • AF275719
• Locus
  6p21.1
• Discovery year
  1990-06-27
• Entrez gene record
  3326
• Pubmed identfication
  • 2768249
  • 16269234
• RefSeq identity
  • NM_007355
• Classification
  • Heat shock 90kDa proteins
• VEGA ID
  OTTHUMG00000014761

Similar products