Rabbit FANCE antibody

• Catalog number
  70R-2296
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  FANCE antibody was raised using the middle region of FANCE corresponding to a region with amino acids SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH
• Specificity
  FANCE antibody was raised against the middle region of FANCE
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FANCE antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  FANCE  
• Gene symbol
  FANCE
• Short name
  Rabbit FANCE antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal FANCE antibody raised against the middle region of FANCE
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  Fanconi anemia, complementation group E, FACE and FAE, FANCE and IDBG-84018 and ENSG00000112039 and 2178, molecular_function, nuclei, Fance and IDBG-158146 and ENSMUSG00000007570 and 72775, FANCE and IDBG-629875 and ENSBTAG00000019492 and 513464

Gene info

• Identity
  HGNC:3586
• Gene
  FANCE
• Long gene name
  FA complementation group E
• Synonyms gene
  • FACE
• Synonyms gene name
  • Fanconi anemia complementation group E
• Synonyms
  • FAE
• GenBank acession
  • AF265210
• Locus
  6p21.31
• Discovery year
  1996-04-09
• Entrez gene record
  2178
• Pubmed identfication
  • 7662964
  • 11001585
• Classification
  • FA complementation groups
  • FA core complex
• VEGA ID
  OTTHUMG00000014565
• Locus Specific Databases
  • Fanconi Anaemia Mutation Database
  • Global Variome shared LOVD
  • LRG_498

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products