Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Rat Cellular tumor antigen p53 Tp53

Recombinant Rat Cellular tumor antigen p53 Tp53 is available 6 times from Bioma labs

RPC20212 | Recombinant Rat Cellular tumor antigen p53(Tp53) size: 1 mg | 1,781.93 USD

Catalog number RPC20212
Supplier bioma
Price 1,781.93 USD
Size 1 mg
Expected molecular weight 47.5kDa
MeSH Data
Tree numbers
  • E01.370.225.500.383.910
  • E01.370.225.500.388.930
  • E05.200.500.383.910
  • E05.200.500.388.930
  • E05.242.383.910
  • E05.242.417.500
  • E05.337.550.200.800
Product images
    #Rat#.png

RPC20212 | Recombinant Rat Cellular tumor antigen p53(Tp53) size: 50 μg | 348.81 USD

Loading

RPC20212 | Recombinant Rat Cellular tumor antigen p53(Tp53) size: 100 μg | 515.97 USD

Loading

RPC20212 | Recombinant Rat Cellular tumor antigen p53(Tp53) size: 200 μg | 775.62 USD

Loading

RPC20212 | Recombinant Rat Cellular tumor antigen p53(Tp53) size: 10 μg | 183.88 USD

Loading

RPC20212 | Recombinant Rat Cellular tumor antigen p53(Tp53) size: 500 μg | 1,201.32 USD

Loading
Other name Tumor suppressor p53
Protein origin E.coli
Estimated production time 7-11 business days
Gene number Tp53
Gene name Tp53
Protein number P10361
Protein sequence MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD
Notes For research use only. Not for diagnostic procedures.
Use before 1 year
Information about sequence Full Length
Storage recommendation Aliquot and store at -20°C. Minimize freezing and thawing.
Shipping requirements Blue ice
Verified reactivity Rattus norvegicus (Rat)
Protein purity ≥ 90%
Protein region 1-391aa
Description Antigens are peptides or recombinant or native dependent on the production method.
About Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
Latin name Rattus norvegicus
Source Recombinants or rec. proteins
Group recombinants
Gene targetCellular tumor p53(Tp53
Short name Recombinant Cellular tumor antigen p53(Tp53)
Technique Recombinant, cellular, antigen
Host Rat
Species Rat
Alternative name recombinant Rat Cellular tumor protein p53(tumor protein p53)
Alternative technique rec
Alternative to gene target tumor protein p53, BCC7 and LFS1 and P53 and TRP53, TP53 and IDBG-26364 and ENSG00000141510 and 7157, MDM2/MDM4 family protein binding, nuclei, Trp53 and IDBG-191036 and ENSMUSG00000059552 and 22059, TP53 and IDBG-635147 and ENSBTAG00000001069 and 281542
Tissue cellular, tumor
Similar products
Rat Cellular tumor antigen p53 TP53 ELISA Kit Suppplier: abebio
Price: 460.25 USD
Recombinant mouse Cellular tumor antigen p53 Suppplier: SAB
Price: 307.57 USD
Recombinant Human Cellular tumor antigen p53 TP53 Suppplier: bioma
Price: 183.88 USD
Ictalurus punctatus Cellular tumor antigen p53 tp53 Suppplier: MBS Recombinant
Price: 2 303.46 USD
Rat Cellular tumor antigen p53 Tp53 Suppplier: MBS Recombinant
Price: 2 345.81 USD
Recombinant Barbus barbus Cellular tumor antigen p53 (tp53) Suppplier: MyBioSource
Price: 1 016.33 USD
Recombinant Bos indicus Cellular tumor antigen p53 TP53 Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Rat Cellular tumor antigen p53 Tp53 Suppplier: Biomatik
Price: 0.00 USD
Recombinant Danio rerio Cellular tumor antigen p53 tp53 Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Mouse Cellular tumor antigen p53 Tp53 Suppplier: Biomatik
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Rat Cellular tumor antigen p53(Tp53) size: 1 mg
Filters
+32-(0)1-658-90-45 [email protected]
  • Cellular
  • tumor
  • p53(Tp53
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee