Recombinant Mouse C-C Motif Chemokine 3/CCL3/MIP-1a(N-6His)

  • Catalog number
    CR13-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Mouse C-C Motif Chemokine 3 is produced by our E.coli expression system and the target gene encoding Ala24-Ala92 is expressed with a 6His tag at the N-terminus.
  • Species reactivity
    Mouse
  • Origin
    Escherichia coli
  • Peptide sequence
    MGSSHHHHHHSSGLVPRGSHMDDDDKAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
  • Estimated molecular weight
    10,8 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,5%Trehalose,1mM EDTA,pH8.0.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH3O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P10855
  • Additional description
    Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CCL3, MIPEP, SMC4, TNPO1, MIP, CCL26, PCK1, MYB, SFTPC, VCX3B
  • Short name
    Recombinant Mouse C-C Motif Chemokine 3/CCL3/MIP-1a(N-6His)
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Recombinant Mouse CCL3(N-6His)
  • Alternative technique
    rec, murine
  • Alternative to gene target
    chemokine (C-C motif) ligand 3, G0S19-1 and LD78ALPHA and MIP-1-alpha and MIP1A and SCYA3, CCL3 and IDBG-776925 and ENSG00000277632 and 6348, identical protein binding, Extracellular
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    structural maintenance of chromosomes 4
  • Synonyms gene
  • Synonyms gene name
    • SMC4 (structural maintenance of chromosomes 4, yeast)-like 1
    • SMC4 structural maintenance of chromosomes 4-like 1 (yeast)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2001-02-22
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Structural maintenance of chromosomes proteins
    • Condensin I subunits
    • Condensin II subunits
    • MicroRNA protein coding host genes
  • VEGA ID
Gene info
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
    MYB
  • Long gene name
    MYB proto-oncogene, transcription factor
  • Synonyms gene name
    • v-myb avian myeloblastosis viral oncogene homolog
  • Synonyms
  • Locus
  • Discovery year
    2001-06-22
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Myb/SANT domain containing
  • VEGA ID
  • Locus Specific Databases
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee