Recombinant Human Erythropoietin/EPO (C-6His)

#
  • Catalog number
    C001-1000
  • Price:

    Please ask

    Ask for price
  • Size
    1 mg
# #
  • Description
    Recombinant Human Erythropoietin is produced by our Mammalian expression system and the target gene encoding Ala28-Arg193 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human Cells
  • Peptide sequence
    APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDRHHHHHH
  • Estimated molecular weight
    19,2 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P01588
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
#
  • Gene target
  • Gene symbol
    EPO, TIMP1, EPX
  • Short name
    Recombinant Erythropoietin/EPO (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Recombinant Human EPO (C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    erythropoietin, EP and MVCD2, EPO and IDBG-31941 and ENSG00000130427 and 2056, protein kinase activator activity, Extracellular, Epo and IDBG-205003 and ENSMUSG00000029711 and 13856, EPO and IDBG-640493 and ENSBTAG00000003430 and 280784
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    TIMP metallopeptidase inhibitor 1
  • Synonyms gene
  • Synonyms gene name
    • tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor)
  • Synonyms
  • Locus
  • Discovery year
    1986-01-01
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Tissue inhibitor of metallopeptidases
  • VEGA ID
  • Locus Specific Databases
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee