Mouse Anti-Mouse Ataxin 1 Monoclonal IgG2b, Clone S76-8
-
Catalog numberSMC-455D-STR
-
PricePlease ask
-
Size100 µg
-
-
CloneS76-8
-
ImmunogenSynthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
-
Antibody s full descriptionMouse Anti-Mouse Ataxin 1 Monoclonal IgG2b Antibody, Clone: S76-8: Streptavidin
-
Antibody s categoryMonoclonal Antibodies
-
Antibody s other nameAtaxin-1 Antibody, ATX1 Antibody, Atxn1 Antibody, D6S504E Antibody, OTTHUMP00000016065 Antibody, SCA1 Antibody, Spinocerebellar ataxia type 1 protein Antibody
-
Raised inMouse
-
Antibody s targetAtaxin 1
-
Primary research fieldsNeuroscience, Neurodegeneration, Cell Signaling, Epigenetics
-
BrandnameNone
-
Antibodies applicationsWB, IHC, ICC/IF, IP
-
Antibody s reactivityHuman, Mouse, Rat
-
Antibody s dilutionsWB (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
-
PurityProtein G Purified
-
Antibody buffer for storagePBS pH 7.4, 50% glycerol, 0.1% sodium azide
-
Antibody s concentration1 mg/ml
-
Antibody s specificityDetects ~85kDa.
-
Storage recommendations-20ºC
-
Shipping recommendationsBlue Ice or 4ºC
-
Antibody certificate of analysis1 µg/ml of SMC-455 was sufficient for detection of Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
-
Antibody in cellCytoplasm , Nucleus
-
Tissue specificitySee included datasheet or contact our support service
-
Scientific contextAtaxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.
-
Released date29-Oct-2013
-
Tested applicationsTo be tested
-
Tested reactivityTo be tested
-
NCBI numberNP_001186233.1
-
Gene number20238
-
Protein numberP54254
-
Antibody s datasheetContact our support service
-
Representative figure link
-
Representative figure legendImmunocytochemistry/Immunofluorescence analysis using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone S76-8 (SMC-455). Tissue: SK-N-BE Cells (Human Neuroblastoma cells). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody (SMC-455) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cytoplasm, Nucleus. Magnification: 60X. Western Blot analysis of Monkey COS-1 cells transfected with Ataxin- 1 showing detection of ~85 kDa Ataxin 1 protein using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone S76-8 (SMC-455). Lane 1: Molecular Weight Ladder. Lane 2: Monkey COS-1 cells transfected with Ataxin- 1. Load: 15 µg. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody (SMC-455) at 1:200 for 16 hours at 4°C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:1000 for 1 hour RT. Color Development: ECL solution for 6 min in RT. Predicted/Observed Size: ~85 kDa. Mouse Anti-Ataxin 1 Antibody [S76-8] used in Immunocytochemistry/Immunofluorescence (ICC/IF) on Human SK-N-BE Cells (Human Neuroblastoma cells) (SMC-455) Mouse Anti-Ataxin 1 Antibody [S76-8 ] used in Western Blot (WB) on Monkey COS-1 cells transfected with Ataxin- 1 (SMC-455)
-
Warning informationNon-hazardous
-
Country of productionCanada
-
Total weight kg1.4
-
Net weight g0.1
-
Stock availabilityIn Stock
-
DescriptionThis antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided. Antibody for research use.
-
AboutMonoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.
-
TestMouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
-
Latin nameMus musculus
-
Gene target
-
Gene symbolSNORD114-8, RNU6-8, SNORD113-8, SNORD116-8, IGKV2OR2-8, MIR1302-8, PIRC35
-
Short nameMouse Anti-Mouse Ataxin 1 Monoclonal IgG2b, Clone S76-8
-
Techniqueanti-, Mouse, anti, antibody to, antibodies, Monoclonals or monoclonal antibodies, mouses
-
Hostmouse
-
IsotypeIgG2b, IgG2b
-
LabelStreptavidin
-
SpeciesMouse, Mouses
-
Alternative nameMouse Antibody toMouse Ataxin 1 monoclonal IgG2b, clonality S76-8
-
Alternative techniquemurine, antibodies
-
Clone nameS76-8
-
Gene info
-
Identity
-
Gene
-
Long gene namesmall nucleolar RNA, C/D box 114-8
-
Synonyms
-
Locus
-
Discovery year2006-09-26
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Small nucleolar RNAs, C/D box
Gene info
-
Identity
-
Gene
-
Long gene nameRNA, U6 small nuclear 8
-
Synonyms
-
Locus
-
Discovery year2008-06-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Small nuclear RNAs
Gene info
-
Identity
-
Gene
-
Long gene namesmall nucleolar RNA, C/D box 113-8
-
Synonyms
-
Locus
-
Discovery year2006-09-20
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Small nucleolar RNAs, C/D box
Gene info
-
Identity
-
Gene
-
Long gene namesmall nucleolar RNA, C/D box 116-8
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2007-02-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Small nucleolar RNAs, C/D box
Gene info
-
Identity
-
Gene
-
Long gene nameimmunoglobulin kappa variable 2/OR2-8 (pseudogene)
-
Synonyms gene name
- immunoglobulin kappa variable 2/OR2-8
- immunoglobulin kappa variable 2/OR2-8 pseudogene
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2000-04-18
-
Entrez gene record
-
RefSeq identity
-
Classification
- Immunoglobulin kappa (IGK) orphons
Gene info
-
Identity
-
Gene
-
Long gene namemicroRNA 1302-8
-
Synonyms gene
-
Synonyms
-
Locus
-
Discovery year2008-11-03
-
Entrez gene record
-
RefSeq identity
-
Classification
- MicroRNA MIR1302 family
Gene info
-
Identity
-
Gene
-
Long gene namepiwi-interacting RNA cluster 35
-
Locus
-
Discovery year2009-11-05
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Piwi-interacting RNA clusters
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data