Mouse Anti-Mouse Ataxin 1 Monoclonal IgG2b, Clone S76-8

  • Catalog number
    SMC-455D-APC
  • Price
    Please ask
  • Size
    100 µg
  • Clone
    S76-8
  • Immunogen
    Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
  • Antibody s full description
    Mouse Anti-Mouse Ataxin 1 Monoclonal IgG2b Antibody, Clone: S76-8: APC
  • Antibody s category
    Monoclonal Antibodies
  • Antibody s other name
    Ataxin-1 Antibody, ATX1 Antibody, Atxn1 Antibody, D6S504E Antibody, OTTHUMP00000016065 Antibody, SCA1 Antibody, Spinocerebellar ataxia type 1 protein Antibody
  • Raised in
    Mouse
  • Antibody s target
    Ataxin 1
  • Primary research fields
    Neuroscience, Neurodegeneration, Cell Signaling, Epigenetics
  • Brandname
    None
  • Antibodies applications
    WB, IHC, ICC/IF, IP
  • Antibody s reactivity
    Human, Mouse, Rat
  • Antibody s dilutions
    WB (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
  • Purity
    Protein G Purified
  • Antibody buffer for storage
    PBS pH 7.4, 50% glycerol, 0.1% sodium azide
  • Antibody s concentration
    1 mg/ml
  • Antibody s specificity
    Detects ~85kDa.
  • Storage recommendations
    -20ºC
  • Shipping recommendations
    Blue Ice or 4ºC
  • Antibody certificate of analysis
    1 µg/ml of SMC-455 was sufficient for detection of Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
  • Antibody in cell
    Cytoplasm , Nucleus
  • Tissue specificity
    See included datasheet or contact our support service
  • Scientific context
    Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.
  • Released date
    29-Oct-2013
  • Tested applications
    To be tested
  • Tested reactivity
    To be tested
  • NCBI number
    NP_001186233.1
  • Gene number
    20238
  • Protein number
    P54254
  • Antibody s datasheet
    Contact our support service
  • Representative figure link
  • Representative figure legend
    Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone S76-8 (SMC-455). Tissue: SK-N-BE Cells (Human Neuroblastoma cells). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody (SMC-455) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cytoplasm, Nucleus. Magnification: 60X. Western Blot analysis of Monkey COS-1 cells transfected with Ataxin- 1 showing detection of ~85 kDa Ataxin 1 protein using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone S76-8 (SMC-455). Lane 1: Molecular Weight Ladder. Lane 2: Monkey COS-1 cells transfected with Ataxin- 1. Load: 15 µg. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody (SMC-455) at 1:200 for 16 hours at 4°C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:1000 for 1 hour RT. Color Development: ECL solution for 6 min in RT. Predicted/Observed Size: ~85 kDa. Mouse Anti-Ataxin 1 Antibody [S76-8] used in Immunocytochemistry/Immunofluorescence (ICC/IF) on Human SK-N-BE Cells (Human Neuroblastoma cells) (SMC-455) Mouse Anti-Ataxin 1 Antibody [S76-8 ] used in Western Blot (WB) on Monkey COS-1 cells transfected with Ataxin- 1 (SMC-455)
  • Warning information
    Non-hazardous
  • Country of production
    Canada
  • Total weight kg
    1.4
  • Net weight g
    0.1
  • Stock availability
    In Stock
  • Description
    This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided. Antibody for research use.
  • About
    Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Gene target
  • Gene symbol
    SNORD114-8, RNU6-8, SNORD113-8, SNORD116-8, IGKV2OR2-8, MIR1302-8, PIRC35
  • Short name
    Mouse Anti-Mouse Ataxin 1 Monoclonal IgG2b, Clone S76-8
  • Technique
    anti-, Mouse, anti, antibody to, antibodies, Monoclonals or monoclonal antibodies, mouses
  • Host
    mouse
  • Isotype
    IgG2b, IgG2b
  • Label
    APC
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse Antibody toMouse Ataxin 1 monoclonal IgG2b, clonality S76-8
  • Alternative technique
    murine, antibodies
  • Clone name
    S76-8
Gene info
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin kappa variable 2/OR2-8 (pseudogene)
  • Synonyms gene name
    • immunoglobulin kappa variable 2/OR2-8
    • immunoglobulin kappa variable 2/OR2-8 pseudogene
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-18
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin kappa (IGK) orphons
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 35
  • Locus
    8
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee