Endoglin, murine recombinant

• Catalog number
  4531-100
• Price
  Please ask
• Size
  100 ug

• Synonyms
  CD105, ENG, END, ORW, HHT1, ORW1, FLJ41744, Endoglin
• Alternative_names
  CD105, ENG, END, ORW, HHT1, ORW1, FLJ41744, Endoglin
• Description
  A part of the TGF beta receptor complex
• Recombinant
  Yes
• Source
  Sf9 cells
• Purity by SDS PAGE
  ≥95%
• Assay
  SDS-PAGE
• Purity
  ≥95%
• Molecular Weight
  75-85 kDa
• Storage Temp
  -20°C
• Shipping
  Gel pack
• Shelf Life
  12 months
• Appearance
  Lyophilized protein
• Physical form description
  Lyophilized from sterile solution without additives
• Reconstitution Instructions
  Centrifuge the vial prior to opening. Reconstitute in sterile PBS to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffers.
• Background Information
  Endoglin is a type I membrane glycoprotein located on cell surfaces and is part of the TGF beta receptor complex.The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts, and smooth muscle cells. Endoglin has been found to be part of the TGF-beta1 receptor complex and may be involved in the binding of TGF-beta1, TGF-beta3, activin-A, BMP-2, and BMP-7. It has been postulated that endoglin is involved in the cytoskeletal organization affecting cell morphology and migration. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling. Its expression is regulated during heart development . CD105 Mouse Recombinant extracellular domain produced in baculovirus is a homodimeric, glycosylated, polypeptide containing 581 amino acids and having a molecular mass of 61 kDa but as a result of glycosylation, migrates at 75-85 kDa under reducing conditions in SDS-PAGE. Based on N-terminal sequence analysis, the primary structure of recombinant mature Endoglin starts at Glu 26. The CD105 is fused to a C-terminal His-tag (6xHis) and purified by proprietary chromatographic techniques.
• Amino acid sequence
  MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLS
• Handling
  Centrifuge the vial prior to opening.
• Usage
  For Research Use Only! Not to be used in humans
• Datasheet
• Additional source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Endoglin   murine  
• Short name
  Endoglin, murine recombinant
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Alternative name
  Endoglin, murine Rec.
• Alternative technique
  rec

MeSH Data

• Name
  Urine Specimen Collection
• Concept
  Scope note: Methods or procedures used to obtain samples of URINE.
• Tree numbers
  • E01.370.225.998.762
  • E05.200.998.762
• Qualifiers
  ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data

Product images

Similar products