TP53BP2 Blocking Peptide

• Catalog number
  33R-9157
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Signal Transduction
• Residues
  TLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKL
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  TP53BP2  
• Gene symbol
  TP53BP2
• Short name
  TP53BP2 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of TP53BP2 antibody, catalog no. 70R-8271
• Alternative technique
  control, peptides
• Alternative to gene target
  tumor protein p53 binding protein, 2, 53BP2 and ASPP2 and BBP and P53BP2 and PPP1R13A, TP53BP2 and IDBG-106878 and ENSG00000143514 and 7159, NF-kappaB binding, nuclei, Trp53bp2 and IDBG-207716 and ENSMUSG00000026510 and 209456, TP53BP2 and IDBG-630822 and ENSBTAG00000012781 and 514474

Gene info

• Identity
  HGNC:12000
• Gene
  TP53BP2
• Long gene name
  tumor protein p53 binding protein 2
• Synonyms gene name
  • tumor protein p53-binding protein, 2
• Synonyms
  • PPP1R13A
  • ASPP2
  • 53BP2
• GenBank acession
  • U09582
• Locus
  1q41
• Discovery year
  1997-06-24
• Entrez gene record
  7159
• Pubmed identfication
  • 8668206
  • 8016121
• RefSeq identity
  • NM_001031685
  • NM_005426
• Classification
  • Ankyrin repeat domain containing
  • Protein phosphatase 1 regulatory subunits
• VEGA ID
  OTTHUMG00000037379

Similar products