Filters
Disease
No filters available
SKU Product name Supplier Catalog no. Size Price
01010269861 Anti- FUS/TLS Antibody Info MBS Polyclonals GEN2525377 0.12 ml Ask Ask
01010583285 Human RNA-binding protein FUS (FUS/TLS) ELISA Kit Info ab-elisa elisas AE43042HU 96 wells plate Ask Ask
01011389617 Human RNA-binding protein FUS (FUS/TLS) ELISA Kit Info abebio AE43042HU-96 1x plate of 96 wells Ask Ask
01011395044 ELISA test for Human RNA-binding protein FUS (FUS/TLS) Info abebio AE43042HU-48 1x plate of 48 wells Ask Ask
01012677896 Human RNA-binding protein FUS (FUS/TLS) ELISA Kit, 96 well plate Info bioma EKC35418 96T Ask Ask
01013657740 FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 Info SFC SFC-27845 1 EA Ask Ask
01013943051 Human MTLSP CRISPR Knock Out 293T Cell Line Info ABM CrispR K1362251 1x10^6 cells/1.0ml Ask Ask
01013943052 Human MTLSP CRISPR Knock Out 293 Cell Line Info ABM CrispR K1362252 1x10^6 cells/1.0ml Ask Ask
01013943053 Human MTLSP CRISPR Knock Out A549 Cell Line Info ABM CrispR K1362253 1x10^6 cells/1.0ml Ask Ask
01013943054 Human MTLSP CRISPR Knock Out HeLa Cell Line Info ABM CrispR K1362254 1x10^6 cells/1.0ml Ask Ask
01013943055 Human MTLSP CRISPR Knock Out MDA-MB-435 Cell Line Info ABM CrispR K1362255 1x10^6 cells/1.0ml Ask Ask
01013943056 Human MTLSP CRISPR Knock Out HepG2 Cell Line Info ABM CrispR K1362256 1x10^6 cells/1.0ml Ask Ask
01013943057 Human MTLSP CRISPR Knock Out MCF7 Cell Line Info ABM CrispR K1362257 1x10^6 cells/1.0ml Ask Ask
01013943058 Human MTLSP CRISPR Knock Out K562 Cell Line Info ABM CrispR K1362258 1x10^6 cells/1.0ml Ask Ask
01013943059 Human MTLSP CRISPR Knock Out U87-MG Cell Line Info ABM CrispR K1362259 1x10^6 cells/1.0ml Ask Ask
01014094883 MTLSP 3'UTR Luciferase Stable Cell Line Info ABM microrna TU014896 1 ml Ask Ask
01014123524 MTLSP 3'UTR GFP Stable Cell Line Info ABM microrna TU064896 1 ml Ask Ask
01014152152 MTLSP 3'UTR Lenti-reporter-Luc Virus Info ABM microrna MV-h14896 3 ml Ask Ask
01014180759 MTLSP 3'UTR Lenti-reporter-GFP Virus Info ABM microrna MV-h64896 3 ml Ask Ask
01014209368 MTLSP 3'UTR Lenti-reporter-Luc Vector Info ABM microrna MT-h14896 1 ug Ask Ask
01014237975 MTLSP 3'UTR Lenti-reporter-GFP Vector Info ABM microrna MT-h64896 1 ug Ask Ask
01014756263 FUS/TLS Info EnoGene E8ET1701-86 100ul Ask Ask
01014803896 Elisa kit to RNA-binding protein FUS (FUS/TLS) (Human) Info Cusabio CSB-E17376h-24 24-wells plate Ask Ask
01014810979 Anti-TLS / FUS Picoband Antibody Info boster A00771-1 100ug/vial Ask Ask
01015801880 Human RNA-binding protein FUS (FUS/TLS) ELISA kit Info Biomatik EKC35418 96 Tests Ask Ask
01015901983 Bulk Linerless B-7643 cable tags for BMP61/BMP71/TLS Info Brady Benelux NL BM71-10x60-7643-BK 1X250Tag(s) Ask Ask
01015901984 Bulk Linerless B-7643 cable tags for BMP61/BMP71/TLS Info Brady Benelux NL BM71-10x60-7643-BL 1X250Tag(s) Ask Ask
01015901985 Bulk Linerless B-7643 cable tags for BMP61/BMP71/TLS Info Brady Benelux NL BM71-10x60-7643-GN 1X250Tag(s) Ask Ask
01015901986 Bulk Linerless B-7643 cable tags for BMP61/BMP71/TLS Info Brady Benelux NL BM71-10x60-7643-OR 1X250Tag(s) Ask Ask
01015901987 Bulk Linerless B-7643 cable tags for BMP61/BMP71/TLS Info Brady Benelux NL BM71-10x60-7643-RD 1X250Tag(s) Ask Ask
01015901988 Bulk Linerless B-7643 cable tags for BMP61/BMP71/TLS Info Brady Benelux NL BM71-10x60-7643-WT 2X250Tag(s) Ask Ask
01015901989 Bulk Linerless B-7643 cable tags for BMP61/BMP71/TLS Info Brady Benelux NL BM71-10x60-7643-YL 2X250Tag(s) Ask Ask
01015901997 Bulk Linerless B-7643 cable tags for BMP61/BMP71/TLS Info Brady Benelux NL BM71-10x75-7643-BK 1X250Tag(s) Ask Ask
01015901998 Bulk Linerless B-7643 cable tags for BMP61/BMP71/TLS Info Brady Benelux NL BM71-10x75-7643-BL 1X250Tag(s) Ask Ask
01015901999 Bulk Linerless B-7643 cable tags for BMP61/BMP71/TLS Info Brady Benelux NL BM71-10x75-7643-GN 1X250Tag(s) Ask Ask
Ajax processing
TLS - Search
Filters
Sitemap Contact
$
  • EUR
  • GBP
  • PLN
  • USD
X
Total products: 993 Current page: 1  Go to first | Next
Contact us
Ajax processing
Close
Chat with gentaur.com employee