Filters
SKU Product name Supplier Catalog no. Size Price
01025327813 HBsAg (ayw) Recombinant Info MyBioSource MBS319182 0.5 mg 1266.56 Ask
02015327375 Beta-Defensin-2 (a.a. 4-41) Peptide[Defensin, beta-2 (a.a. 4-41), Human] Info MyBioSource MBS318034 NA 5.54 Ask
02015327583 Parainfluenza Type 1 Ag (VP1)[Parainfluenza 1, Strain VP1] Info MyBioSource MBS318469 NA 5.54 Ask
02015327813 HBsAg (ayw) Recombinant[Hepatitis B Surface Antigen (HBsAg) (ayw) Recombinant] Info MyBioSource MBS319182 NA 5.54 Ask
02015378885 Trypsin Inhibitor, Ovomucoid[Trypsin Inhbitor, Ovomucoid (OI)] Info MyBioSource MBS545009 NA 5.54 Ask
02015423472 Enniatin A (Lateritin I)[Enniatin A] Info MyBioSource MBS651457 NA 5.54 Ask
03015386942 Pantoprazole Sodium Hydrate[Pantoprazole Sodium Hydrate] Info MyBioSource MBS575080 50 mg 5.54 Ask
03015387574 Docetaxel trihydrate[Docetaxel trihydrate] Info MyBioSource MBS575714 50 mg 5.54 Ask
03015387743 Cozymasei[Cozymasei] Info MyBioSource MBS575886 50 mg 5.54 Ask
03015426580 Trypsin Inhibitor, Ovomucoid (Egg White)[Trypsin Inhibitor, Ovomucoid] Info MyBioSource MBS655378 NA 5.54 Ask
04025327813 HBsAg (ayw) Recombinant Info MyBioSource MBS319182 5x0.5 mg 5441.88 Ask
Search
Filters
Sitemap Contact
$
  • EUR
  • GBP
  • PLN
  • USD
Total products: 11 Current page: 1  Go to first
  • CO 1

  • DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

  • Egg White

  • Enniatin A

  • RP 56976

  • SK F 96022

  • Vero CellsStrain VP1

  • ayw subtype

  • Clear all
Contact us
Ajax processing
Close
Chat with gentaur.com employee