Search

01016987947 Rabbit anti-SAM b, Rabbit polyclonal antibody to S-Adenosylmethionine Arthus Biosystems PA00201-100 100μg Ask

01016987950 Rabbit anti-SAM a, Rabbit polyclonal antibody to S-Adenosylmethionine Arthus Biosystems PA00201-50 50μg Ask

01016988095 Rabbit anti-MAT s, Rabbit polyclonal antiserum against methionine adenosyltransferase Arthus Biosystems PA00401-50 50μl Ask

01016988097 Rabbit anti-MAT g, Rabbit polyclonal antiserum against methionine adenosyltransferase with glycerol Arthus Biosystems PA00402-50 50μl Ask

01018634074 CNP (2,3-cyclic nucleotide-3-phosphodiesterase) Polyclonal Antibody Leading Biology APG03227G 50 μl Ask

01018634075 Glial Fibrillary Acidic Protein (GFAP) Polyclonal Antibody Leading Biology APG03337G 100 μl Ask

01025267122 Biotin-labeled rabbit anti-human antiplasmin, affinity purified MyBioSource MBS135154 0.1 mg 621.72

01025267129 Sheep anti-human CRP, biotin labeled affinity purified MyBioSource MBS135161 0.1 mg 516.80

01025267141 Sheep anti mouse prothrombin IgG fraction, affinity purified MyBioSource MBS135173 0.1 mg 616.14

01025267151 Immuno absorbed sheep anti mouse Factor X MyBioSource MBS135183 0.1 mg 591.59

01025267153 Sheep anti-Human Prothrombin - Affinity Purified MyBioSource MBS135185 0.1 mg 443.13

01025267171 Sheep anti human PSA IgG fraction, high titer MyBioSource MBS135203 0.1 mg 516.80

01025267173 Affinity purified sheep anti mouse neuroserpin MyBioSource MBS135205 0.1 mg 553.64

01025267187 Affinity purified sheep anti mouse tPA, biotin labeled MyBioSource MBS135219 0.5 mg 800.32

01025267188 Sheep anti rat prorenin prosegment, affinity purified MyBioSource MBS135220 0.1 mg 553.64

01025267197 Affinity purified sheep anti mouse tPA MyBioSource MBS135229 0.1 mg 455.41

01025267200 Biotin labeled affinity purified sheep anti human renin MyBioSource MBS135232 0.1 mg 670.84

01025267201 Sheep anti-human plasminogen, affinity purified MyBioSource MBS135233 0.1 mg 455.41

01025267210 Sheep anti-human plasmin, affinity purified MyBioSource MBS135242 0.1 mg 455.41

01025267212 Sheep anti-human PAI-1, affinity purified MyBioSource MBS135244 0.1 mg 455.41

01025267237 Biotin labeled affinity purified sheep anti mouse neuroserpin MyBioSource MBS135269 0.5 mg 800.32

01025267255 Sheep anti-human CRP, affinity purified MyBioSource MBS135287 0.1 mg 455.41

01025267272 Sheep anti rat & mouse prorenin/renin IgG fraction, High Titer MyBioSource MBS135304 0.1 mg 616.14

01025267292 Sheep anti mouse prothrombin, biotin labeled affinity purified MyBioSource MBS135325 0.1 mg 670.84

01025267374 Biotin-labeled sheep anti rat & mouse prorenin/renin IgG fraction, High Titer MyBioSource MBS135407 0.1 mg 616.14

01025267387 Sheep anti human renin IgG fraction, affinity purified MyBioSource MBS135420 0.1 mg 670.84

01025267391 Affinity purified sheep anti mouse factor X MyBioSource MBS135424 0.1 mg 591.59

01025267424 Rabbit anti-human antiplasmin, affinity purified MyBioSource MBS135457 0.1 mg 621.72

01025326733 Squamous Cell Carcinoma Antigen 1 (SCCA-1) Recombinant MyBioSource MBS313447 0.01 mg 430.85

01025371177 IL17E antibody MyBioSource MBS535942 0.05 mg 535.78

01025397778 BNIP3 (Bcl2/Adenovirus E1B 19kD Protein-Interacting Protein 3, 19kD Interacting Protein 3, NIP3) MyBioSource MBS610584 0.1 mL 770.18

01025397949 APC6 (ANAPC6, Anaphase Promoting Complex 4, CDC16) MyBioSource MBS610936 0.05 mg 948.77

01025398047 BRCT Domain Containing 1 (BRCTD1, BRCTX, DKFZP564C0469) MyBioSource MBS611172 0.05 mg 1022.44

01025398062 Tubby Protein (TULP, Tubby-like Protein, Tub Homolog) MyBioSource MBS611201 0.1 mL 973.33

01025398184 DNA PK, Catalytic Subunit (DNA-dependent Protein Kinase) MyBioSource MBS611495 0.05 mg 1022.44

01025398597 DDR1 (Discoidin Domain Receptor 1, CAK, CD167, EC 2.7.10.1, EDDR1, HGK2, MCK10, NEP, NTRK4, PTK3, PTK3A, RTK6, TRKE) MyBioSource MBS612408 0.05 mg 948.77

01025398636 CARD10 (Caspase Recruitment Domain, Bimp1, CARMA3) MyBioSource MBS612500 0.05 mg 1102.81

01025398715 CTRP4 (C1q Tumor Necrosis Factor alpha Related Protein 4, C1qTNF4, ZACRP4) MyBioSource MBS612690 0.05 mg 948.77

01025398785 DDR1 (Discoidin Domain Receptor 1, CAK, CD167, EC 2.7.10.1, EDDR1, HGK2, MCK10, NEP, NTRK4, PTK3, PTK3A, RTK6, TRKE) MyBioSource MBS612846 0.05 mg 948.77

01025399470 CXCL2 (Gro beta, MIP-2) MyBioSource MBS614445 0.1 mg 1029.14

01025399527 Cerebellin Precursor (Cbln1, Precerebellin) MyBioSource MBS614566 0.05 mg 1102.81

01025399543 AMP Activated Protein Kinase gamma1 (AMPK g1) MyBioSource MBS614598 0.1 mL 770.18

01025399782 ALS2CR2 (Amyotrophic Lateral Sclerosis 2 (juvenile) Chromosome Region,candidate 2) MyBioSource MBS615164 0.05 mg 948.77

01025399812 CARD8 (Caspase Recruitment Domain, Cardinal/TUCAN) MyBioSource MBS615231 0.05 mg 948.77

01025400285 APC10 (Anaphase Promoting Complex 10, ANAPC10, DKFZP564L0562, DOC1) MyBioSource MBS616326 0.05 mg 1022.44

01025400548 ARMER, CT (ARL6IP, ARL6IP1, AIP1) MyBioSource MBS616934 0.05 mg 1102.81

01025400689 EphA4 Receptor (Ephrin A4 Receptor) MyBioSource MBS617244 0.05 mg 948.77

01025400693 CTRP7, NT (C1q Tumor Necrosis Factor alpha Related Protein 7, C1qTNF7, ZACRP7) MyBioSource MBS617253 0.05 mg 948.77

01025400945 RSK3 (Ribosomal S6 Kinase 3, RSK-3, pp90RSK3, 90kD Ribosomal Protein S6 Kinase 2, p90-RSK 2, p90RSK2, MAP Kinase-activated Protein Kinase 1c, MAPK-activated Protein Kinase 1c, MAPKAP Kinase 1c, MAPKAPK1C, MAPKAPK-1c, Ribosomal Protein S6 Kinase alpha-2, R MyBioSource MBS617856 0.1 mL 770.18

01025401015 Jumonji Domain Containing Protein 1B (JMJD1B, JmjC Domain-containing Histone Demethylation Protein 2B, JHDM2B, KDM3B, 5qNCA, Nuclear Protein 5qNCA) MyBioSource MBS618004 0.1 mL 770.18

1 36 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

CL 40881

Cell CultureSource CHO Cells

Inactivated adenovirus type 5

Source Sheep serum

rabbit