Recombinant Human Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS140668-02	Recombinant Human Dual Specificity Phosphatase 6
MBS144434-02	Recombinant Human Dual Specificity Phosphatase 19
MBS144482-04	Recombinant Human Dual Specificity Phosphatase 3
MBS144528-01	Recombinant Human Dual Specificity Phosphatase 10
MBS144713-02	Recombinant Human Dual Specificity Phosphatase 21
MBS144713-04	Recombinant Human Dual Specificity Phosphatase 21
MBS144952-02	Recombinant Human Dual Specificity Phosphatase 23
MBS145054-04	Recombinant Human Dual Specificity Phosphatase 13
MBS145574-04	Recombinant Human Dual Specificity Phosphatase 26
MBS146321-04	Recombinant Human Dual Specificity Phosphatase 22

Recombinant Human Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)

CAT:

399-CSB-EP013412HUj9-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)

Gene Name: MAP2K3
UniProt: P46734
Expression Region: 1-347aa
Organism: Homo sapiens
Target Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
Tag: C-terminal 6xHis-Avi-tagged
Source: E.coli
Field of Research: Cancer
Assay Type: In Stock Protein
Relevance: Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14.
Purity: Greater than 95% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 42 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP621973HU-03	Recombinant Human Dual specificity protein phosphatase 6 (DUSP6)
CSB-EP865123HU-02	Recombinant Human Dual specificity protein phosphatase 22 (DUSP22)
CSB-EP865123HU-01	Recombinant Human Dual specificity protein phosphatase 22 (DUSP22)
CSB-EP865123HU-03	Recombinant Human Dual specificity protein phosphatase 22 (DUSP22)
CSB-EP007243HU-03	Recombinant Human Dual specificity protein phosphatase 14 (DUSP14)
CSB-EP863128HU-02	Recombinant Human Dual specificity protein phosphatase 26 (DUSP26)
CSB-EP863128HU-01	Recombinant Human Dual specificity protein phosphatase 26 (DUSP26)
CSB-EP863128HU-03	Recombinant Human Dual specificity protein phosphatase 26 (DUSP26)
CSB-EP621973HU-02	Recombinant Human Dual specificity protein phosphatase 6 (DUSP6)
CSB-EP621973HU-01	Recombinant Human Dual specificity protein phosphatase 6 (DUSP6)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on