Recombinant Lithobates catesbeiana SaXIphilin, partial
CAT:
399-CSB-BP339158LQA-03
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
-SDS.jpg)

-SDS.jpg&w=128&q=75)

Recombinant Lithobates catesbeiana SaXIphilin, partial
- CAS Number: 9000-83-3
- UniProt: P31226
- Expression Region: 484-844aa
- Organism: Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)
- Target Sequence: AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC
- Tag: C-terminal 9xHis-tagged
- Source: Baculovirus
- Field of Research: Others
- Assay Type: Developed Protein
- Relevance: Binds specifically to the neurotoxin saXItoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Function: Binds specifically to the neurotoxin saXItoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe (3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin.
- Molecular Weight: 41.7 kDa
- References & Citations: "Molecular cloning of bullfrog saXIphilin: a unique relative of the transferrin family that binds saXItoxin."Morabito M.A., Moczydlowski E.Proc. Natl. Acad. Sci. U.S.A. 91:2478-2482 (1994)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- : true