Recombinant Escherichia coli FMN reductase (NADPH) (ssuE) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS9420925-02	Recombinant Escherichia coli Escherichia coli
MBS9420925-01	Recombinant Escherichia coli Escherichia coli
MBS9420925-03	Recombinant Escherichia coli Escherichia coli
MBS9420925-04	Recombinant Escherichia coli Escherichia coli
MBS1100155-01	Recombinant Escherichia coli
MBS1100155-02	Recombinant Escherichia coli
MBS1100155-03	Recombinant Escherichia coli
MBS1100155-05	Recombinant Escherichia coli
MBS1100155-04	Recombinant Escherichia coli
PCR-VHA207-PCRVHA20796D	Escherichia coli

Recombinant Escherichia coli FMN reductase (NADPH) (ssuE)

CAT:

399-CSB-BP305338ENV-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Escherichia coli FMN reductase (NADPH) (ssuE)

Gene Name: ssuE
UniProt: P80644
Expression Region: 1-191aa
Organism: Escherichia coli (strain K12)
Target Sequence: MRVITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTFTEQLQQADGLIVATPVYKAAYSGALKTLLDLLPERALQGKVVLPLATGGTVAHLLAVDYALKPVLSALKAQEILHGVFADDSQVIDYHHRPQFTPNLQTRLDTALETFWQALHRRDVQVPDLLSLRGNAHA
Tag: C-terminal 6xHis-tagged
Source: Baculovirus
Field of Research: Others
Assay Type: In Stock Protein
Relevance: Catalyzes an NADPH-dependent reduction of FMN, but is also able to reduce FAD or riboflavin.
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 26.9 kDa
References & Citations: "Crystal Structure of Escherichia coli SsuE: Defining a General Catalytic Cycle for FMN Reductases of the Flavodoxin-like Superfamily." Driggers CM, Dayal PV, Ellis HR, Karplus PA. Biochemistry 53 3509-19 (2014)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Escherichia coli FMN reductase (NADPH) (ssuE), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP6086ENR(A4)-01	Recombinant Escherichia coli Aconitate hydratase
CSB-EP6086ENR(A4)b1-03	Recombinant Escherichia coli Aconitate hydratase
CSB-EP301231ENV-01	Recombinant Escherichia coli Chaperedoxin (cnoX)
CSB-EP301231ENV-03	Recombinant Escherichia coli Chaperedoxin (cnoX)
CSB-EP321945ENV-01	Recombinant Escherichia coli nicotinamidase (pncA)
CSB-EP001447ENM-03	Recombinant Escherichia coli Agmatinase (speB)
CSB-EP300968ENV-02	Recombinant Escherichia coli Flagellin (fliC)
CSB-EP300968ENVe1-03	Recombinant Escherichia coli Flagellin (fliC)
CSB-EP300968ENVe1-02	Recombinant Escherichia coli Flagellin (fliC)
CSB-EP365319ENV-01	Recombinant Escherichia coli Exopolyphosphatase (ppx)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on