Recombinant Arabidopsis thaliana Glucan endo-1, 3-beta-glucosidase 10 (At5g42100)

Recombinant Arabidopsis thaliana Glucan endo-1, 3-beta-glucosidase 10 (At5g42100)

• CAS Number: 9000-83-3
• Gene Name: At5g42100
• UniProt: Q9FHX5
• Expression Region: 27-425aa
• Organism: Arabidopsis thaliana (Mouse-ear cress)
• Target Sequence: IGINYGQVANNLPPPKNVIPLLKSVGATKVKLYDADPQALRAFAGSGFELTVALGNEYLAQMSDPIKAQGWVKENVQAYLPNTKIVAIVVGNEVLTSNQSALTAALFPAMQSIHGALVDCGLNKQIFVTTAHSLAILDVSYPPSATSFRRDLLGSLTPILDFHVKTGSPILINAYPFFAYEENPKHVSLDFVLFQPNQGFTDPGSNFHYDNMLFAQVDAVYHALDAVGISYKKVPIVVSETGWPSNGDPQEVGATCDNARKYNGNLIKMMMSKKMRTPIRPECDLTIFVFALFNENMKPGPTSERNYGLFNPDGTPVYSLGIKTSSTHSSGSGSSNSTGGSSSGGGGNTGGSSSGGGIYQPVTGNPSPDYMSISSAGGKGRFVECVLFFFLLCIIKLRLKLLQPGR
• Tag: N-terminal 6xHis-EGFP-tagged
• Source: Baculovirus
• Field of Research: Others
• Assay Type: Developed Protein
• Relevance: Plasmodesmal-associated membrane beta-1, 3-glucanase involved in plasmodesmal callose degradation and functions in the gating of plasmodesmata.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Full Length of Mature Protein
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 71.5 kDa
• References & Citations: "Subcellular dynamics and role of Arabidopsis beta-1, 3-glucanases in cell-to-cell movement of tobamoviruses." Zavaliev R., Levy A., Gera A., Epel B.L. Mol. Plant Microbe Interact. 26:1016-1030 (2013)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.