CDKN2A, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CDKN2A, Human
Description :
CDKN2A Protein, a potent negative regulator of cell proliferation, forms strong interactions with CDK4 and CDK6, hindering their association with cyclins D and retinoblastoma protein phosphorylation. Acting in a heterodimeric manner, predominantly with CDK6, CDKN2A inhibits cyclin D-CDK4 kinase activity and interacts with ISCO2, contributing to its cell cycle regulatory role. CDKN2A Protein, Human is the recombinant human-derived CDKN2A protein, expressed by E. coli , with tag free.Product Name Alternative :
CDKN2A Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/cdkn2a-p16ink4a-protein-human.htmlPurity :
99.00Smiles :
EPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPDMolecular Formula :
1029 (Gene_ID) P42771 (E2-D156) (Accession)Molecular Weight :
Approximately 19.12 kDaShipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

