Recombinant Toxoplasma gondII Dense granule protein 6 (GRA6) , partial
CAT:
399-CSB-EP631656TOV1e0-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Toxoplasma gondII Dense granule protein 6 (GRA6) , partial
- CAS Number: 9000-83-3
- Gene Name: GRA6
- UniProt: Q27003
- Expression Region: 35-150aa
- Organism: TOV-Toxoplasma gondII
- Target Sequence: NSLGGVAVAADSGGVKQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQGDSLAEDDTTSEAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKR
- Tag: N-terminal GST-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: In Stock Protein
- Relevance: Major granular component involved in excreted-secreted antigen (ESA) immunity. May have a structural role in the membranous network of the parasitophorous vacuole (PV).
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 38.6 kDa
- References & Citations: "Characterization of a dense granule antigen of Toxoplasma gondII (GRA6) associated to the network of the parasitophorous vacuole." Lecordier L., Moleon-Borodowsky I., Dubremetz J.-F., Tourvieille B., Mercier C., Deslee D., Capron A., Cesbron-Delauw M.-F. Mol. Biochem. Parasitol. 70:85-94 (1995)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.