Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A, R130S) (Active)

Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A, R130S) (Active)

• CAS Number: 9000-83-3
• Gene Name: TSLP
• UniProt: A0A7N9CAT7
• Expression Region: 29-159aa(R127A,R130S)
• Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
• Target Sequence: YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKARKSKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
• Tag: C-terminal 10xHis-tagged
• Source: Mammalian cell
• Field of Research: Immunology
• Assay Type: Active Protein & In Stock Protein
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: Loaded Cynomolgus TSLP (R127A, R130S) on 96-Flat plate,  can bind anti-TSLP antibody (CSB-RA025141MA1HU),  with an affinity constant of 4.41 nM as determined in BLI assay  (Gator Prime).
• Length: Full Length of Mature Protein
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 16.4 kDa
• References & Citations: Warren W., Wilson R.K. Submitted to EMBL/GenBank/DDBJ databases (MAR-2013)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Protein Length: Full Length of Mature Protein