Recombinant Human Ribonuclease 7 (RNASE7)

CAT:
399-CSB-EP872431HU-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Ribonuclease 7 (RNASE7) - image 1

Recombinant Human Ribonuclease 7 (RNASE7)

  • Product Name Alternative:

    (RNase 7) (Skin-derived antimicrobial protein 2) (SAP-2)
  • Abbreviation:

    Recombinant Human RNASE7 protein
  • Gene Name:

    RNASE7
  • UniProt:

    Q9H1E1
  • Expression Region:

    29-156aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    KPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Epigenetics and Nuclear Signaling
  • Relevance:

    Exhibits a potent RNase activity . Has broad-spectrum antimicrobial activity against many pathogenic microorganisms and remarkably potent activity (lethal dose of 90% < 30 nM) against a vancomycin resistant Enterococcus faecium . Causes loss of bacterial membrane integrity. Probably contributes to urinary tract sterility . Bactericidal activity is independent of RNase activity.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    18.6 kDa
  • References & Citations:

    "Insights into the antimicrobial mechanism of action of human RNase6: structural determinants for bacterial cell agglutination and membrane permeation." Pulido D., Arranz-Trullen J., Prats-Ejarque G., Velazquez D., Torrent M., Moussaoui M., Boix E. Int. J. Mol. Sci. 17:552-552 (2016) .
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein