Recombinant Human Interleukin-6 (IL6) (Active)
CAT:
399-CSB-YP011664HU-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No








Recombinant Human Interleukin-6 (IL6) (Active)
- CAS Number: 9000-83-3
- Gene Name: IL6
- UniProt: P05231
- Expression Region: 30-212aa
- Organism: Homo sapiens
- Target Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
- Tag: N-terminal 6xHis-tagged
- Source: Yeast
- Field of Research: Cancer
- Assay Type: Active Protein & In Stock Protein
- Relevance: Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism.
- Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human IL6 at 2 μg/mL can bind Anti-IL6 recombinant antibody (CSB-RA011664MA1HU). The EC50 is 35.80-41.82 ng/mL.
- Length: Full Length of Mature Protein
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 250mM Imidazole 6% Trehalose, pH 8.0
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 22.8 kDa
- References & Citations: "Complementary DNA for a novel human interleukin (BSF-2) that induces B lymphocytes to produce immunoglobulin." Hirano T., Yasukawa K., Harada H., Taga T., Watanabe Y., Matsuda T., Kashiwamura S., Nakajima K., Koyama K., Kishimoto T. Nature 324:73-76 (1986) "Structure and expression of human B cell stimulatory factor-2 (BSF-2/IL-6) gene." Yasukawa K., Hirano T., Watanabe Y., Muratani K., Matsuda T., Nakai S., Kishimoto T. EMBO J. 6:2939-2945 (1987)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.