Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 8 (DDB_G0280329)
CAT:
399-CSB-CF706883DKK-02
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 8 (DDB_G0280329)
- CAS Number: 9000-83-3
- Gene Name: DDB_G0280329
- UniProt: Q54VH7
- Expression Region: 1-375aa
- Organism: Dictyostelium discoideum (Slime mold)
- Target Sequence: MIDLFDFVVLSSFIILLPLVTDFLNNTFPNAKIGRLAQEVVGMILVFFIVSLIFAGVSLWYTHFLPFYYTKSLLISFDTLNLLDLLKFINTDNNNNSGSSIFNKITFYFHIFFTIQLVVNLYYYYYQTITADNFLPKISKNKQIQLFASETTTTTTTTTDNINEKKNKLCGLCDQVSDGKWSTINKPKSHHCRICKRCIDSMDHHCPFAANCIGINNHHYFILFIGYTVMALIYACYLSFFPYYHCIVNYKNYVSLSFTNDNDNDNNNNNNFKQLAQSCAKFNKYSFIFLCCCLIVTASFGILLFQTYLIITNSKTVQLLSRLKKSKSFLDWFKWLYQNFKQNASINNIYSLFPNFKFYNLIIPYYKRKINKLNK
- Tag: N-terminal 10xHis-tagged
- Source: in vitro E.coli expression system
- Field of Research: Others
- Assay Type: CF Transmembrane Protein & In Stock Protein
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 49.9 kDa
- References & Citations: "Analyses of cDNAs from growth and slug stages of Dictyostelium discoideum." Urushihara H., Morio T., Saito T., Kohara Y., Koriki E., Ochiai H., Maeda M., Williams J.G., Takeuchi I., Tanaka Y. Nucleic Acids Res. 32:1647-1653 (2004)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.