TSLP Antibody / Thymic stromal lymphopoietin

CAT:
800-R32884
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
TSLP Antibody / Thymic stromal lymphopoietin - image 1

TSLP Antibody / Thymic stromal lymphopoietin

  • Description:

    Thymic stromal lymphopoietin, also called TSLP is a protein belonging to the cytokine family. This gene is mapped to 5q22.1. It encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c (+) dendritic cells. The protein promotes T helper type 2 (TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. The protein is therefore considered a potential therapeutic target for the treatment of such diseases.
  • Specifications:

    Western Blot: 0.5-1 µg/mL
  • UniProt:

    Q9JIE6
  • Host:

    Rabbit
  • Reactivity:

    Mouse, Rat
  • Immunogen:

    Amino acids QEMAQEVQNICLNQTSQILRLWYSFMQSPE were used as the immunogen for the TSLP antibody.
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Applications:

    WB
  • Purity:

    Antigen affinity
  • Format:

    Antigen affinity purified
  • Buffer:

    Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
  • Reconstitution:

    After reconstitution, the TSLP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations:

    This TSLP antibody is available for research use only.
  • Storage Conditions:

    After reconstitution, the TSLP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation:

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes:

    Optimal dilution of the TSLP antibody should be determined by the researcher.
  • CAS Number:

    9007-83-4
  • Location:

    Secreted
  • Image Legend:

    Western blot testing of 1) mouse liver, 2) mouse kidney, 3) mouse testis, 4) rat heart, 5) rat liver, 6) rat kidney and 7) rat testis lysate with TSLP antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa.