PRKAB1 Antibody / AMPK beta 1

CAT:
800-R32363
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PRKAB1 Antibody / AMPK beta 1 - image 1

PRKAB1 Antibody / AMPK beta 1

  • Description:

    5'-AMP-activated protein kinase subunit beta-1 is an enzyme that in humans is encoded by the PRKAB1 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK) . AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.
  • Specifications:

    Western blot: 0.1-0.5 µg/mL, Immunofluorescence (FFPE) : 2-4 µg/mL
  • UniProt:

    Q9Y478
  • Host:

    Rabbit
  • Reactivity:

    Human
  • Immunogen:

    Amino acids DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE of human AMPK beta 1 were used as the immunogen for the PRKAB1 antibody.
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Applications:

    WB, IF
  • Purity:

    Antigen affinity
  • Format:

    Antigen affinity purified
  • Buffer:

    Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
  • Reconstitution:

    After reconstitution, the PRKAB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations:

    This PRKAB1 antibody is available for research use only.
  • Storage Conditions:

    After reconstitution, the PRKAB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation:

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes:

    Optimal dilution of the PRKAB1 antibody should be determined by the researcher.
  • CAS Number:

    9007-83-4
  • Image Legend:

    Immunofluorescent staining of FFPE human A431 cells with PRKAB1 antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.