SAPK4 Antibody

CAT:
800-R31807
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SAPK4 Antibody - image 1

SAPK4 Antibody

  • Description:

    MAPK13 (Mitogen-Activated Protein Kinase 13), also called p38-DELTA or Stress-Activated Protein Kinase 4 (SAPK4), is an enzyme that in humans is encoded by the MAPK13 gene. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.
  • Specifications:

    Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL
  • UniProt:

    O15264
  • Host:

    Rabbit
  • Reactivity:

    Human, Mouse, Rat
  • Immunogen:

    Amino acids KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL of human MAPK13/SAPK4 were used as the immunogen for the SAPK4 antibody.
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Applications:

    WB, IHC-P
  • Purity:

    Antigen affinity
  • Format:

    Antigen affinity purified
  • Buffer:

    Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
  • Reconstitution:

    After reconstitution, the SAPK4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations:

    This SAPK4 antibody is available for research use only.
  • Storage Conditions:

    After reconstitution, the SAPK4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation:

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes:

    Optimal dilution of the SAPK4 antibody should be determined by the researcher.
  • CAS Number:

    9007-83-4
  • Location:

    Nuclear, cytoplasmic
  • Image Legend:

    Western blot testing of 1) rat kidney, 2) human HeLa, and 3) human A549 lysate with SAPK4 antibody. Expected/observed molecular weight ~42 kDa.