Recombinant Human Potassium channel subfamily K member 9 (KCNK9) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS9422192-03	Recombinant Human Potassium-transporting ATPase subunit beta
MBS9420021-01	Recombinant Human Potassium-transporting ATPase subunit beta
MBS1297923-01mgEColi	Recombinant Human Potassium channel regulatory protein (KCNRG)
MBS1297923-01mgYeast	Recombinant Human Potassium channel regulatory protein (KCNRG)
MBS9420021-02	Recombinant Human Potassium-transporting ATPase subunit beta
MBS9422192-02	Recombinant Human Potassium-transporting ATPase subunit beta
MBS9420021-04	Recombinant Human Potassium-transporting ATPase subunit beta
MBS1297923-002mgBaculovirus	Recombinant Human Potassium channel regulatory protein (KCNRG)
MBS1297923-002mgEColi	Recombinant Human Potassium channel regulatory protein (KCNRG)
MBS1297923-002mgYeast	Recombinant Human Potassium channel regulatory protein (KCNRG)

Recombinant Human Potassium channel subfamily K member 9 (KCNK9)

CAT:

399-CSB-CF889068HU-01

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Potassium channel subfamily K member 9 (KCNK9)

Gene Name: KCNK9
UniProt: Q9NPC2
Expression Region: 1-374aa
Organism: Homo sapiens
Target Sequence: MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV
Tag: N-terminal 10xHis-tagged
Source: in vitro E.coli expression system
Field of Research: Neuroscience
Assay Type: CF Transmembrane Protein & Developed Protein
Relevance: pH-dependent, voltage-insensitive, background potassium channel protein.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 48.3 kDa
References & Citations: "SUMOylation silences heterodimeric TASK potassium channels containing K2P1 subunits in cerebellar granule neurons." Plant L.D., Zuniga L., Araki D., Marks J.D., Goldstein S.A. Sci. Signal. 5:RA84-RA84 (2012)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Potassium channel subfamily K member 9 (KCNK9), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-CF889073HU-02	Recombinant Human Inward rectifier potassium channel 16 (KCNJ16)
CSB-CF889073HU-01	Recombinant Human Inward rectifier potassium channel 16 (KCNJ16)
CSB-YP002343HU-03	Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial
CSB-EP009090HU-01	Recombinant Human Sodium/potassium-transporting ATPase subunit gamma (FXYD2)
CSB-EP009090HU-03	Recombinant Human Sodium/potassium-transporting ATPase subunit gamma (FXYD2)
CSB-CF012071HU-01	Recombinant Human Potassium channel subfamily K member 3 (KCNK3)
CSB-CF889068HU-02	Recombinant Human Potassium channel subfamily K member 9 (KCNK9)
CSB-CF862058HU-02	Recombinant Human Potassium channel subfamily K member 13 (KCNK13)
CSB-EP002343HUe1-02	Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial
CSB-EP002343HU-01	Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on