Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS7037581-02	Recombinant Enterobacteria phage P2 Holin (Y)
RPC22408-1mg	Recombinant Enterobacteria phage T4 Fibritin (wac)
MBS1097102-03	Recombinant Enterobacteria phage T5 Exodeoxyribonuclease (D15)
MBS7037579-03	Recombinant Enterobacteria phage lambda Holin (S)
MBS1486329-03	Recombinant Enterobacteria phage MX1 Capsid protein
MBS1486329-04	Recombinant Enterobacteria phage MX1 Capsid protein
MBS1082096-03	Recombinant Enterobacteria phage ZR Coat protein
MBS1082096-05	Recombinant Enterobacteria phage ZR Coat protein
MBS1190595-01	Recombinant Enterobacteria phage f2 Coat protein
MBS1190595-03	Recombinant Enterobacteria phage f2 Coat protein

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY)

CAT:

399-CSB-EP366179EDZe1-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY)

Gene Name: uvsY
UniProt: P04537
Expression Region: 1-137aa
Organism: Enterobacteria phage T4 (Bacteriophage T4)
Target Sequence: MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK
Tag: Tag-Free
Source: E.coli
Field of Research: Others
Assay Type: Developed Protein
Relevance: Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 15.8 kDa
References & Citations: "Two bacteriophage T4 base plate genes (25 and 26) and the DNA repair gene uvsY belong to spatially and temporally overlapping transcription units." Gruidl M.E., Chen T.C., Gargano S., Storlazzi A., Cascino A., Mosig G. Virology 184:359-369 (1991)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP360435EDZ-01	Recombinant Enterobacteria phage T4 Endolysin (E)
CSB-EP319157EDZ-02	Recombinant Enterobacteria phage T4 Fibritin (wac)
CSB-EP319157EDZ-03	Recombinant Enterobacteria phage T4 Fibritin (wac)
CSB-EP356100FQZ-02	Recombinant Enterobacteria phage Qbeta Coat protein
CSB-EP356100FQZ-01	Recombinant Enterobacteria phage Qbeta Coat protein
CSB-EP360435EDZ-03	Recombinant Enterobacteria phage T4 Endolysin (E)
CSB-EP319157EDZ-01	Recombinant Enterobacteria phage T4 Fibritin (wac)
CSB-EP356100FQZ-03	Recombinant Enterobacteria phage Qbeta Coat protein
CSB-EP360435EDZ-02	Recombinant Enterobacteria phage T4 Endolysin (E)
CSB-EP361288EDZ-03	Recombinant Enterobacteria phage T4 Sliding clamp (45)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on