Recombinant Klebsiella pneumoniae Phosphoethanolamine--lipid A transferase MCR-8.1 (mcr-8) , partial
CAT:
399-CSB-EP4611KBG-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Klebsiella pneumoniae Phosphoethanolamine--lipid A transferase MCR-8.1 (mcr-8) , partial
- CAS Number: 9000-83-3
- Gene Name: mcr-8
- UniProt: A0A2U7XX87
- Expression Region: 177-565aa
- Organism: Klebsiella pneumoniae
- Target Sequence: KDYASLIRNNMQIKDQALPFNFVRNTNGYLKRKYQASSTILQSVGEDAVRPIYSNAPPKLVVVVVGETARAQNFQLNGYSRVTNPYLSRRHDVISFKNVSSCGTATAISLPCMFSRMSRNEYNEVRAASEENLLDILKRTGVEVLWRNNNNGGCKGICKRVPTDDMPAMKVIGECVNKDGTCFDEVLLNQLSSRINAMQGDALIVLHQMGSHGPTYFERYPSTSKVFSPTCDSNLIEKCSNKELVNTYDNTLVYTDRMLSKTIELLQRYSGMRDVAMIYLSDHGESLGESGIYLHGTPYIIAPNEQTHIPMFMWFSSSFAQHSKLNLECLTGNADKQYSHDNFYHSILGLFNVKTSVYKPELDMFTLCRQSDHTPLSSAVVREKTDGNG
- Tag: N-terminal 6xHis-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: Developed Protein
- Relevance: Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 46.0 kDa
- References & Citations: Identification and characterization of BH3 domain protein Bim and its isoforms in human hepatocellular carcinomas.Miao J., Chen G.G., Yun J.P., Chun S.Y., Zheng Z.Z., Ho R.L.K., Chak E.C., XIa N.S., Lai P.B.Apoptosis 12:1691-1701 (2007)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.