Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23

Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23

• CAS Number: 9000-83-3
• UniProt: L7N6F8
• Expression Region: 22-90aa
• Organism: Dermatophagoides pteronyssinus (European house dust mite)
• Target Sequence: ANDNDDDPTTTVHPTTTEQPDDKFECPSRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT
• Tag: N-terminal 6xHis-tagged
• Source: E.coli
• Field of Research: Others
• Assay Type: Developed Protein
• Relevance: Does not bind chitin in vitro.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Full Length of Mature Protein
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 10.3 kDa
• References & Citations: "Identification of Der p 23, a Peritrophin-like Protein, as a New Major Dermatophagoides pteronyssinus Allergen Associated with the Peritrophic Matrix of Mite Fecal Pellets." Weghofer M., Grote M., Resch Y., Casset A., Kneidinger M., Kopec J., Thomas W.R., Fernandez-Caldas E., Kabesch M., Ferrara R., Mari A., Purohit A., Pauli G., Horak F., Keller W., Valent P., Valenta R., Vrtala S. J. Immunol. 190:3059-3067 (2013)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.