Recombinant Pseudomonas aeruginosa Elastase (lasB), partial | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
Oneq-VHA154-OneqVHA15450D	Pseudomonas aeruginosa
PCR-VHA154-PCRVHA15448D	Pseudomonas aeruginosa
IMS01 -133-332	Pseudomonas aeruginosa
FR297	Pseudomonas aeruginosa
Oneq-VHA154-OneqVHA154100D	Pseudomonas aeruginosa
Oneq-VHA154-OneqVHA154150D	Pseudomonas aeruginosa
PCR-VHA154-PCRVHA15496D	Pseudomonas aeruginosa
MBS6248258-01	Pseudomonas aeruginosa (P. aeruginosa) (AP)
MBS6249266-01	Pseudomonas aeruginosa (P. aeruginosa) (Biotin)
MBS6248258-02	Pseudomonas aeruginosa (P. aeruginosa) (AP)

Recombinant Pseudomonas aeruginosa Elastase (lasB), partial

CAT:

399-CSB-YP318584EZX-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected].

Recombinant Pseudomonas aeruginosa Elastase (lasB), partial

Gene Name: lasB
UniProt: P14756
Expression Region: 198-498aa
Organism: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Sequence: AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL
Tag: N-terminal 6xHis-tagged
Source: Yeast
Field of Research: Others
Assay Type: In Stock Protein
Relevance: Cleaves host elastin, collagen, IgG, and several complement components as well as endogenous pro-aminopeptidase. Autocatalyses processing of its pro-peptide. Processes the pro-peptide of pro-chitin-binding protein (cbpD). Involved in the pathogenesis of P.aeruginosa infections.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 35.2 kDa
References & Citations: "Molecular characterization and nucleotide sequence of the Pseudomonas aeruginosa elastase structural gene."Bever R.A., Iglewski B.H.J. Bacteriol. 170:4309-4314 (1988)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Pseudomonas aeruginosa Elastase (lasB), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP318584EZX-02	Recombinant Pseudomonas aeruginosa Elastase (lasB)
CSB-EP318584EZX-01	Recombinant Pseudomonas aeruginosa Elastase (lasB)
CSB-EP318584EZX-03	Recombinant Pseudomonas aeruginosa Elastase (lasB)
CSB-EP326492EZX-02	Recombinant Pseudomonas aeruginosa Beta-lactamase (ampC)
CSB-EP881236EZX-03	Recombinant Pseudomonas aeruginosa Protein hcp1 (hcp1)
CSB-EP881236EZX-01	Recombinant Pseudomonas aeruginosa Protein hcp1 (hcp1)
CSB-YP318584EZX-01	Recombinant Pseudomonas aeruginosa Elastase (lasB), partial
CSB-EP312664EZX1-02	Recombinant Pseudomonas aeruginosa Serralysin (aprA), partial
CSB-YP318584EZX-03	Recombinant Pseudomonas aeruginosa Elastase (lasB), partial
CSB-EP875877EZX-02	Recombinant Pseudomonas aeruginosa Lysyl endopeptidase (prpL)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on