Recombinant Human Vascular endothelial growth factor A protein (VEGFA) , partial (Active)

CAT:
399-CSB-AP002591HU-03
Size:
500 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Vascular endothelial growth factor A protein (VEGFA) , partial (Active) - image 1

Recombinant Human Vascular endothelial growth factor A protein (VEGFA) , partial (Active)

  • Gene Name:

    VEGFA, VEGF
  • UniProt:

    P15692
  • Expression Region:

    27-191aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
  • Tag:

    Tag-Free
  • Source:

    Yeast
  • Field of Research:

    Cancer
  • Assay Type:

    Active Protein & In Stock Protein
  • Relevance:

    Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. {ECO:0000269|PubMed:11427521, ECO:0000269|PubMed:16489009}.
  • Endotoxin:

    Less than 1.0 EU/µg as determined by LAL method.
  • Purity:

    >97% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells (HUVEC) is between 1.0-8.0 ng/ml.
  • Length:

    Partial of Isoform 4
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity).
  • Molecular Weight:

    19.3 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3